KEGG   Xanthomonas campestris pv. raphani: XCR_0117Help
Entry
XCR_0117          CDS       T01872                                 

Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00010  Glycolysis / Gluconeogenesis
xcp00620  Pyruvate metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_0117
   00620 Pyruvate metabolism
    XCR_0117
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XCR_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AEL05047
UniProt: G0CHN3
LinkDB All DBs
Position
122743..124272
Genome map
AA seq 509 aa AA seqDB search
MNALPSAKSLNSDPQSIFKPRYDNFIGGAWVAPQGGQYFDNTTPITGKVFTSIARSTAPD
IEAALDAAHAAKEAWGKTSTTDRSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMEVIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDTFMEKALKRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAEILIGGERNMLDGELSDGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttccttccgccaagtccctcaacagcgacccgcaatccatcttcaaacca
cgctacgacaacttcatcggcggggcgtgggtggcgccgcaaggtggtcagtatttcgac
aacaccacgccgatcaccggcaaggtcttcacctcgatcgcgcgctctaccgcgccagat
atcgaagccgcgctggatgcggcgcatgcggccaaggaggcgtggggcaagacctccacc
accgatcgctccaacgtgctgctcaagatcgccgaccgtatcgagcagaacctggaattg
ctggcgtatgccgagacctgggacaacggcaaaccggtgcgcgaaacgctcaacgccgac
gtgccgctgtgcgtggatcacttccgctatttcgccggtgccatccgcgcgcaggaaggt
ggcatctccgagatcgacagcgacaccattgcctatcatttccacgagccactcggcgtg
gtggggcagatcatcccgtggaactttccgctgctgatggcctgctggaaactcgcgcct
gcactggcggccggcaattgcgtggtgatgaagccggccgagcagaccccggcctcgatc
ctggtgctgatggaagtgatcggcgatctgctgccgcccggcgtgctcaacgtagtgaac
ggcttcgggcttgaggcgggcaagccgctggccagcaatccgcgcatcgccaagatcgcc
ttcactggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatc
ccggtaacgctggagctgggcggcaaatcgcccaacatcttctttgccgatgtcatggcc
gaagacgatgactttctcgacaaggcggtggaaggtttcgtgctgtttgccttcaaccag
ggcgaggtctgtacctgcccgtcgcgcgcgctgatccaggaatcgatctacgacacattc
atggaaaaggcgctcaagcgcgtggcggcgatcaagcagggcaacccgctggatcccaac
accatggtcggcgcgcaggcttccagcgagcagctggaaaagattctgtcttacatcgac
atcggcaagcaggagggcgccgaaatcctgatcggtggcgagcgcaacatgctcgacggg
gagctatcggacggtttctatgtcaagcccacggtgttcaagggccacaacaagatgcgc
gtgtttcaggaagaaatcttcggcccggtggtgtcggtgaccaccttcaaggacgaggcc
gacgcgttggcgatcgccaacgacaccttgtacggattgggcgccggcgtgtggagccgc
gatgcctcgcgcctgtaccgcatgggccgcgcgatccaggccggccgcgtgtggaccaac
tgctaccacgcctatcccgcgcacgccgccttcggtggctacaagcagtcgggcatcggc
cgcgaaaaccacaagatgatgctcgaccattaccagcagaccaagaacctgctggtgagc
tattcgccaaaggcgcttgggttcttctga

DBGET integrated database retrieval system