KEGG   Xanthomonas campestris pv. raphani: XCR_0122Help
Entry
XCR_0122          CDS       T01872                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    XCR_0122 (ligD)
Enzymes [BR:xcp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XCR_0122 (ligD)
DNA repair and recombination proteins [BR:xcp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     XCR_0122 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C LigD_N mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEL05052
UniProt: G0CHN8
LinkDB All DBs
Position
126939..129791
Genome map
AA seq 950 aa AA seqDB search
MACSRVGRCPKGPSLRAGEKRLAVQVEDHPLAYAGFEGDIPQGQYGAGHVQVFDHGTWHC
DGDALAALDAGKLDFDLQGDKLRGGFALVRTRLRGRQPQWLLIKRDDAHAADLDADALVA
DSDATAQAIETPSAAAAPARRAKASRRRRTPAEALVTEKSASASRPRASAATQAHWRTRA
LALPGARDAACPTGLRAQLTLLRAEAPDGAQWLHEIKWDGYRLLTDLVDGRAQLRSRNDQ
AWTDSFPEVATAVQALPVRDARLDGELVVLDAQGRSDFSALQRAIDGTARQPLRYLVFDL
LGVAGVDLRATPLLERKQVLRALLGETPGTLAYSAHVIGRGPEVFAASADKGWEGIVSKR
ADAPYRGGRSADWVKTKHEDSDEFVVVGYTDPKGARSGFGALLLAQLEGRQLRYVGRVGT
GFDSALLGEITAQLQALHSPQPTLELPAHIPGRPRDVHWVRPVLIAEVAFRGWAKQGLLR
QAAFKRLREDKPMSDLGGDRATPGKPRGARTRMAAAAGKASRAVATRTAAASAGGSAAKP
GKASKSSTAAEVSTPSRVAKQRVASAASSAAKPGKPGKSSAAATGNASPRVAKRGAVSAA
SASSAAKSGKRTVSGESAASSKPAAPAKDASSRAARTPGTSSAKKTSTAPAAAPTRKAKA
PASTAPDGVAITHPERVVFPAAGISKGDVAAYYRAVAPLVLPEIARRPLSLLRCPDGAAG
MCFFQKHEGHHLGAHIKAIPLKQKSGTEDYLYIEDVAGLLELVQMNTLELHPWGARVDDP
EHPDRLVFDLDPGEGVAWTQVVAAAREIRSKLRAAGLESAVRLSGGKGLHVVVPIVPQAS
WDQARDFCEAFAQALATQAPERYVATMSKAKRHGVIFVDWLRNGRGNTSVCSWSLRARAH
ATVAVPLRWEELGKLSGPDAFPLDKAVQRAKRQRNDPWADVLALKQVLPG
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgctcaagagttgggcggtgccccaagggcccgtcgctgcgtgctggcgaaaaa
cgcctggcggtgcaggtggaggatcacccgcttgcgtacgcgggcttcgaaggcgacatc
ccgcaagggcagtacggggccggccacgtgcaggtattcgaccacggcacctggcactgc
gatggcgacgcgttggcggcgctggatgccggcaagctggactttgacttgcagggcgac
aagctgcgcggtggctttgcgctggtccgcacccgcctgcgtgggcgccagccgcagtgg
ctgttgatcaagcgcgacgatgcccatgccgccgatctggacgccgatgcgttggtagcc
gattccgatgccacagcgcaggcgatcgagactccatcggctgcagccgcaccggcgcgc
cgtgccaaggccagccgtcgtcgacgcacgccggccgaggcgttggtgacagaaaaatcc
gcatccgccagccgcccgcgtgcttccgcagccacacaggcccactggcgcacgcgcgca
ctggccttgccgggcgcgcgcgatgcggcctgtcccaccggcttgcgcgcgcagctgacg
ttgctgcgcgctgaggcgccggatggtgcgcagtggctgcacgagatcaagtgggacggc
taccggttgttgaccgatctggtcgatggccgggcgcaactgcgctcgcgcaacgatcag
gcctggacggacagctttccggaagttgccacggccgtgcaggcgttgccggtgcgcgat
gcgcgcctggatggcgaactggtggtactcgatgcgcaaggccgcagcgatttctccgcg
ctgcagcgtgccatcgacggcactgcgcgccagcctttgcgctacctggtgttcgatctg
ctcggcgttgccggcgtggatctgcgcgccaccccgctgctggagcgcaagcaggtgttg
cgtgcgttgctcggcgaaacgccgggcacgctggcctatagcgcgcatgtgatcggccgc
ggaccggaggtgtttgccgccagtgccgacaaaggctgggaaggcatcgtcagcaaacgc
gcagacgcgccgtaccgtggtgggcgcagcgccgattgggtcaagaccaagcacgaagac
agcgacgagttcgtggtggtgggctacaccgaccccaagggcgcgcgcagcgggtttggc
gccctgttgctggcacagctggagggcaggcagctgcgctacgtgggccgggtcgggacc
ggtttcgacagtgccctgctcggcgagatcaccgcgcaattgcaggcattgcacagcccg
caacccacgctggaactacctgcgcatattcccggccggccgcgcgatgtgcactgggta
cgcccggtgttgattgccgaggtggcgttccgtggctgggccaagcagggcctgctgcgg
caggcggccttcaagcgtttacgcgaggacaaaccaatgagcgatctgggcggcgaccgc
gccacgccgggcaagccgcggggagcacgcacgcggatggctgctgctgcgggcaaggcg
tcacgtgctgtagcgacgcgcactgcggcggcatcggctggcggttcggctgcaaagccg
ggtaaggcgagcaagtcttccactgcggccgaggtcagcacaccgtcgcgtgtcgccaaa
caacgtgtggcatctgcagccagttccgctgccaagccaggaaagccgggcaagtcttcc
gcagcggccacgggcaatgcatcgccgcgtgtggccaaacgaggtgcggtgtctgccgcc
agcgcatcgtctgcggcgaagtcgggcaagcgcaccgtttccggcgagtctgcggcgtcc
agcaagccggccgcgccggccaaggacgcatcgtccagagcggcacgcacgccaggtacg
tcgtcggcaaagaaaacgtcgacagcaccggcggcggcgcccacgaggaaagcaaaggca
ccggcctctaccgcgccagacggcgttgccattacccatcccgagcgcgtggtgttccct
gccgccggcatcagcaagggcgatgtggccgcgtattaccgcgcggtggcaccgctggtg
ttgccggagattgcgcgccggccgttgtcgttgttgcgctgccccgatggcgctgcaggc
atgtgctttttccagaagcacgaaggccaccatcttggtgcgcacatcaaggccatcccg
ctgaagcagaagagcggcaccgaagattatctgtacatcgaggatgtggccgggctgctg
gaattggtgcagatgaacaccctggagctgcatccctggggcgcgcgggtggatgacccc
gagcaccccgaccggctggtgttcgacctggatccgggcgaaggcgtggcctggacgcag
gtggtagccgccgcacgcgagatccgcagcaagttgcgtgcggccgggctcgaaagcgcc
gtgcgcctgtcgggtggcaagggactgcacgtggtggtgccgatcgtgccgcaggccagc
tgggaccaagcacgcgatttctgcgaagccttcgcacaggccttggccacccaggccccg
gagcgctatgtggccaccatgagcaaggccaagcgtcacggcgtgatctttgtcgactgg
ctgcgcaacgggcgcggcaataccagcgtgtgctcgtggtcgctacgcgcgcgcgcgcac
gccaccgtggcggtgccgctgcgctgggaagaactgggcaaactcagcggcccggatgcg
ttcccgctggacaaggccgtgcagcgcgcaaagcgtcagcgcaatgatccctgggcggat
gtgctggcgttgaagcaggtgttgcctggctag

DBGET integrated database retrieval system