KEGG   Xanthomonas campestris pv. raphani: XCR_0893Help
Entry
XCR_0893          CDS       T01872                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00473  D-Alanine metabolism
xcp00550  Peptidoglycan biosynthesis
xcp01100  Metabolic pathways
xcp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XCR_0893
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XCR_0893
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    XCR_0893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xcp01011]
    XCR_0893
Enzymes [BR:xcp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     XCR_0893
Peptidoglycan biosynthesis and degradation proteins [BR:xcp01011]
 Precursor biosynthesis
  Amino acid ligase
   XCR_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEL05810
UniProt: G0CDA7
LinkDB All DBs
Position
934178..935134
Genome map
AA seq 318 aa AA seqDB search
MSAQIAPSRISDPAMFGRVAVLLGGTSSEREVSLNSGSNVLDALRARGVDAQPVDGIPAL
AQALVAQRFDRVFNVLHGHNGGGEDGIVQGLMEAFGVPYTGSNVLGSALSMDKIRTKQVW
LSLGLSTPRYARLAAGASAQQIHAAAGQIGLPVIVKPANEGSSVGVSRVFDQAQLEEAVT
LAARYDGALLMEQLIEGDELTVAVLGDVALPSIRIVPKGQWYDYNAKYIAEDTQYLCPGL
DGDAEAQIGQLALDAFRAAGCSGWGRVDVMRDGSTGQLYLLEVNTAPGMTSHSLVPKAAR
QLGIDFEALVWRVLEQTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacagatcgccccctcgcgcatcagcgacccggccatgttcggccgggttgca
gtgctgctcggcggcacctcgtccgagcgcgaggtctcgctcaactccggcagcaatgtg
ctcgatgccctgcgcgcgcgcggcgtcgatgcgcagccggtcgacggcattccggcattg
gcgcaggcattggtcgcgcagcgcttcgaccgcgtcttcaacgtgctgcatggtcacaac
ggcggcggcgaagacggcatcgtgcaggggttgatggaggccttcggcgtgccgtacacc
ggctccaacgtgctcggctcggcgctgagcatggacaagattcgcaccaagcaggtctgg
ctgtcgctgggcctgtccacgccgcgctacgcacggcttgccgccggcgccagcgcgcag
cagatccacgccgctgccgggcagatcggcttgccagtgatcgtgaagccggccaacgaa
ggctccagcgtcggcgtcagccgcgtgttcgaccaggcgcagctcgaagaggccgtgacg
cttgccgcacgctacgacggcgcgctgctgatggaacaactgatcgaaggcgacgagctc
actgtcgccgtgctcggcgatgtggcgctgccgtcgatccgcatcgtgcccaagggccag
tggtacgactacaacgccaagtacatcgccgaagacacgcagtacctgtgcccgggactt
gatggcgacgcagaagcacagatcggccagctcgccctggatgcgttccgcgccgccggc
tgcagcggctggggtcgcgtggacgtgatgcgcgatggcagcaccggccagctgtacctg
ctggaagtgaacaccgccccgggcatgaccagccactcgctggtgcccaaggccgcccgc
caactcggcatcgacttcgaagcgctggtctggcgcgtgttggagcagacgctatga

DBGET integrated database retrieval system