KEGG   Xanthomonas campestris pv. raphani: XCR_1545Help
Entry
XCR_1545          CDS       T01872                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp03030  DNA replication
xcp03410  Base excision repair
xcp03420  Nucleotide excision repair
xcp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XCR_1545
   03410 Base excision repair
    XCR_1545
   03420 Nucleotide excision repair
    XCR_1545
   03430 Mismatch repair
    XCR_1545
Enzymes [BR:xcp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XCR_1545
    6.5.1.6  DNA ligase (ATP or NAD+)
     XCR_1545
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     XCR_1545
DNA replication proteins [BR:xcp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    XCR_1545
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     XCR_1545
DNA repair and recombination proteins [BR:xcp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     XCR_1545
   NER (nucleotide excision repair)
    Other NER factors
     XCR_1545
   MMR (mismatch exicision repair)
    Other MMR factors
     XCR_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEL06444
UniProt: G0CJM0
LinkDB All DBs
Position
complement(1579200..1580804)
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYRTLDRSTGTLDKRAALVAYFRAAPPLDAAWALYLLAGGKVASARMRIAASGE
LREWIAEAAGIADWLVADSYDHVGDLAETLALLLDDPASEAVDVSLAEWIEQRLLPIANQ
DVAMRKHCIVQAWRTLAFDERLVFNKLLTGALRVGVSQRLVQQALAELSGVDIARIAQRM
LGSWRPHATYVADLLTHEELPGDRQQPYPFFLASPLEADVESLGAIDDWLLEWKWDGIRL
QLLRRAGEAALWSRGEERLDGRFPEIEQAAMGLPDGTVIDGELLAWQPEQPLPMPFTALQ
TRIQRLKPGPKTLAAAPARVVAYDLLELDGEDLRERPLRARRALLERVLATLADPRIIAS
PLVHSTDWQAAAQVRLDARARGVEGLMLKRARSPYQSGRRRGDWWKWKIDPLTIDAVLLY
AQAGHGRRSTLYTDYTFGLWHGGTLVPIAKAYSGLDDTEILQLDRWIRANTTERFGPVRA
VTPHHVFELGFEGVNRSTRHKSGIAVRFPRILRWRHDKPFAEADHLSSLQALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggtttgcagcgctgtaccgcaccctggaccgcagcaccggcacgctcgacaag
cgcgccgccttggtggcttatttccgcgcagcgccgccgctggatgcggcctgggcgctg
tatctgctggccggtggcaaggtggccagcgcgcgcatgcgcatcgccgccagcggcgag
ttgcgcgagtggatcgccgaggccgccgggatcgccgactggctggtagccgacagctac
gatcacgtgggcgatctggccgaaacactggcattgctgctggatgatccagccagcgag
gcggtggatgtgtcactggccgagtggatcgagcagcgcctgctgccgatcgccaatcaa
gacgtggcgatgcgcaagcactgcatcgtgcaggcgtggcgcacgctcgccttcgacgaa
cgcctggtcttcaacaagttgctgaccggcgccctgcgcgtgggggtgtcgcaacggttg
gtgcagcaggccctggcagaactgtctggcgtggatatcgcacgcattgcccagcgcatg
ctcggcagctggcgcccgcatgccacgtatgtggccgacctgctcacgcatgaggagctg
cccggcgaccgccagcagccctacccgttttttcttgcatcgccgctggaggccgatgtc
gaaagccttggcgccatcgacgactggctgctggaatggaagtgggatggcatccggctg
cagctgttgcgtcgtgccggtgaagcggcgctgtggtcgcgtggcgaagaacgcctggat
ggccgctttccagagatcgaacaggccgccatgggcttgccagacggcaccgtgatcgac
ggcgagctgctggcctggcaaccagagcaaccgttgccgatgccgttcaccgcgctgcag
acgcgtatccagcggctcaagcccgggcccaagacgctggcggccgccccagcgcgcgtg
gtcgcttacgacctgctcgaactggacggcgaagacctgcgcgagcgcccgctgcgtgca
cgccgcgcactactggagcgcgtgctcgccaccctcgccgacccacgcattatcgcctcg
ccgctggtgcactccaccgattggcaggccgccgcgcaggtgcggctggatgcacgtgcg
cgcggcgttgaagggctgatgctcaagcgcgcgcgttcgccctaccaatccggccgccgc
cgtggcgactggtggaagtggaagatcgacccactgaccatcgatgcggtgctgctgtac
gcacaggccggccatggccggcgcagcacgctctacaccgactacaccttcgggctctgg
cacggcggcacgctggtgcccatcgccaaggcgtattcgggcctggacgataccgagatc
ctgcaactggatcgctggatccgcgccaacaccaccgagcgcttcgggccggtgcgcgca
gtcacgccgcaccatgtgttcgaactgggctttgaaggcgtgaatcgcagcacgcggcac
aagtccggcattgcggtgcgcttcccgcgcatcctgcgctggcgccacgacaaacccttc
gccgaggccgatcacctgagcagcctgcaggcactggcgcggtga

DBGET integrated database retrieval system