KEGG   Xanthomonas campestris pv. raphani: XCR_3122Help
Entry
XCR_3122          CDS       T01872                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00330  Arginine and proline metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01130  Biosynthesis of antibiotics
xcp01230  Biosynthesis of amino acids
Module
xcp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    XCR_3122 (proC)
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     XCR_3122 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N DUF2007 AA_kinase GFO_IDH_MocA TetR_N
Motif
Other DBs
NCBI-ProteinID: AEL07986
UniProt: G0C9S3
LinkDB All DBs
Position
3297409..3298269
Genome map
AA seq 286 aa AA seqDB search
MTQPSSSTAVAAHGDVPVVAFVGGGNMARSLIAGLLRQGAPASAIRVAEPVAELRQALSA
DFGVQVFDDARSAVEGAALWVLAVKPQVMSTVCTQLADLAQQQHPLLLSIAAGITATQLE
RWCGGTAAVVRAMPNTPALLGAGVTGLYANARVSAAQRAQATRLLESAGVTVWLDDEAQM
DAVTAVSGSGPAYVFLLAEAMEAAARAQGLPAETARTLVLHTLLGAARMLTESGEAPEVL
RRRVTSPNGTTQAAIEAFQAGGFEALTATAIAAATERGRNLSAAND
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccttcctcctccacagctgtggctgcacacggcgatgttccggtggtcgcc
tttgtcggcggcggcaacatggcgcgcagcctgatcgccgggctgctgcgccagggcgcg
ccggccagcgccatccgcgtcgccgagccggtcgccgaactgcgtcaggcgctgtccgcc
gacttcggcgtgcaggtgttcgacgacgcgcgcagcgccgtggagggcgccgcactctgg
gtactggcggtcaagccgcaggtcatgtccaccgtgtgcacgcagctggccgatctcgcg
cagcaacagcatccgctgctgctgtcgatcgccgcgggcatcaccgcaacgcaactggag
cgctggtgcggcggcacggccgccgtggtgcgcgccatgcccaacacgccggccctgctc
ggcgccggcgtgaccggcctgtacgccaatgcacgcgtcagcgcggcgcagcgcgcgcag
gcaacccggctgctggaaagcgccggcgtcaccgtctggctcgacgacgaggcacagatg
gatgcggtcaccgcggtgtccggcagcggcccggcctatgtctttctgctggccgaagcg
atggaggccgcggcgcgcgcgcaaggcctgcccgccgagaccgcccgcacgctggtgctg
cataccctgctcggcgctgcacgcatgctgaccgaatccggcgaagcaccggaggtattg
cgccggcgcgtgacctcccccaacggcaccacgcaggccgcgatcgaggcattccaggcc
ggcggtttcgaagcgctgaccgccaccgcgattgccgcggcgaccgaacgcggccgcaat
ttgtcggcagccaacgactga

DBGET integrated database retrieval system