KEGG   Xanthomonas campestris pv. raphani: XCR_4336Help
Entry
XCR_4336          CDS       T01872                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Brite
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XCR_4336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEL09192
UniProt: G0CLZ9
LinkDB All DBs
Position
complement(4645546..4646193)
Genome map
AA seq 215 aa AA seqDB search
MRILPTTLFLATALVLTACKRDEPAPAEPAPAAQAGTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNEVKGTVTFKTVDGALRVTGQLSGLKPNSEHGFHIHEKGDCSAPDGSSAG
GHFNPAQTDHGMVGADPHHGGDMPNIKADAQGNASIDGPVASNVNLGKADQSDIAGHAVI
VHADPDDYKTQPTGNAGGRLACGVITTDNAPAPTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattcttcccaccaccctgttcctggccaccgcgctggtcctgacggcctgcaaa
cgcgacgagcccgccccggccgaaccagcgcccgccgcgcaggccggcaccccggccgaa
gccgcccacggcggcgagcatgccgcctcgatggtcaccgaagcggcggccaccaccacg
gccaccgccgagctcaagccgaccaagggcaatgaggtcaagggcacagtcaccttcaag
accgtggacggtgcgctgcgggtcaccggccaactgagcgggctcaagcccaacagcgag
cacggcttccacattcatgaaaagggcgattgcagtgcgccggacggcagcagcgccggc
ggccacttcaacccggcccagaccgaccacggcatggtcggcgccgacccgcatcacggt
ggcgacatgcccaacatcaaggccgatgcgcagggcaatgccagcatcgacggtccggtg
gcgagcaacgtcaacctgggcaaggccgaccagtccgacatcgccggccacgccgtgatc
gtccacgccgacccggacgactacaagacccagcccaccggcaacgccggcggccgcctg
gcttgcggcgtgatcaccaccgacaacgcgcccgcaccgaccaagtaa

DBGET integrated database retrieval system