KEGG   Xanthomonas campestris pv. raphani: XCR_4438Help
Entry
XCR_4438          CDS       T01872                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00052  Galactose metabolism
xcp00511  Other glycan degradation
xcp00600  Sphingolipid metabolism
xcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    XCR_4438
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    XCR_4438
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XCR_4438
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XCR_4438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: AEL09294
UniProt: G0CA23
LinkDB All DBs
Position
complement(4757169..4760045)
Genome map
AA seq 958 aa AA seqDB search
MQQQATTAAQRVSECGVGVAMTGAMRLRVVLYRLCRRARDGRPGTTQQPLQRSLRAGCMA
LTCLCTTAGVVTAAEPTNAPRERISLNADWRFQRGDPPGNTVRLEYDVRPEVVRSEDGKV
ADARPEQAQHIDADARDVLKPWILPTANSLIADPTQRHVRPPGHPGSAVAYVQPTFDDSA
WQRVDLPHDWAIAGPFLADGPHGGMGRLPSWGVGWYRKALQIPASDRGRSLFLDLDGAMS
YATVWLNGKLVGGWPYGYTSWRVDLTPYVVPGGHNQLAIRLDNPPDSARWYPGGGLYRNV
WLTKTGPLRVAQWGTQLSTPQVSAERAQVQLAVQLDNAGAAPVQAQVSTALYALDDASGL
RRGPAVAQIAAVQVQVAAGGSARVQGSTQIEAPRRWGPPPTQQPHRYVAVTEVSQGGRVV
DRVETPFGVRSVVFDPDKGLVINGEHVPIRGVNNHHDLGALGAAFNVRAAERQLQLLQQM
GANAIRMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLIFPQWHEPDLRAML
RRDRNHPSIILWSVGNEVGEQYTGEAGAAIARRLHAIVHAEDPTRPATAAMNYASPEMPL
PAALDVISLNYQGEGIRDTPEFEGTERIRKLPQYPAFHAKFPRKAILSSETASALSSRGV
YLFPVSAQSSAPVRDGRGGDSVAHQVSAYELHAVDFGSSADKVFAALDRHPFVAGEFVWT
GFDYLGEPTPYYSSRSSYSGILDLAGFPKDRYWLYQARWRPELPMAHLLPHWSWPGREGQ
VTPVHVFTSGDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELRVQAYKHGKPWASD
RVQTAGRATRMQLSADRSRIRGDGKDLSFITVRLLDANGRPAPTAGDRLRFRVEGAGELV
ATDNGDPTNLEAFVLPERNAFNGLCLVIVRAKPGAQGPITVHVQSDTLQSASVQVRAE
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcaggcaaccacggccgcacagcgcgtgagcgagtgcggcgtaggtgtggcg
atgaccggtgccatgcgcctacgcgttgtgctgtatcgcctctgcaggcgtgcacgcgat
gggcgcccaggcactacgcagcagccgctgcagcgcagcctgcgcgctggatgcatggcg
ctgacctgcctctgcactaccgcaggtgtggtcacagcggcggagccaaccaacgcgccg
cgcgaacggatctcgctcaacgccgactggcgcttccagcgtggcgacccgcctggcaat
accgtgcggctggagtacgacgtacgcccggaggtggttcgcagcgaagacggcaaggtg
gccgatgcgcggcccgagcaggcgcaacacatcgacgccgacgcgcgcgacgtgctcaaa
ccgtggatcctgccgactgccaatagcctgatcgccgaccccacgcagcggcatgtgcgc
ccgcccgggcacccgggcagtgcggtggcctacgtgcagcccacgttcgatgacagcgcg
tggcagcgcgtggacctgccacacgattgggcaatcgcagggccgttcctggccgatggc
ccgcatggcggcatggggcgattgccgagctggggcgttggctggtatcgcaaggcgctg
cagattccggccagcgaccgcggccgctcgctgtttctcgatctcgatggcgcgatgtcc
tacgccaccgtctggctcaacggcaagctggtgggcggctggccgtacggctacaccagc
tggcgcgtggatctcacgccgtacgtggtgccgggcgggcacaaccagctcgcgatccgg
ctggacaacccgcctgattcggcgcgttggtatcccggtggtggcctgtatcgcaacgtc
tggctgaccaagaccggcccgctccgcgttgcccagtggggcacgcagctgagcacaccg
caggtgtcggccgagcgcgcgcaggtgcagctggcggtgcagctggacaatgccggtgcc
gcccccgtgcaggcgcaggtgagcaccgcgctgtacgcgctggatgacgccagcggcctg
cgccgtggcccggcggtggcgcagattgccgcggtgcaggtacaggtggcggcgggtggc
agtgcacgcgtgcagggcagtacgcagatcgaggcgccacggcgttggggcccaccaccg
acacagcaaccgcatcgctatgtcgcggtgaccgaggtcagccagggtgggcgcgtggtc
gatcgtgtcgaaacgccgttcggcgtgcgcagcgtggtcttcgacccggacaagggcttg
gtcatcaacggcgaacatgtgcccatccgcggggtcaacaaccatcacgatctgggcgcg
ctcggggccgcgttcaacgtgcgcgccgccgagcggcagctgcagttactgcaacagatg
ggcgccaatgccatccgcatgagccacaacccgcccgcgccggaattgctggagctcacc
gaccgcatgggcctgctggtggtggacgaggtgttcgacagctgggaaatgaaaaagacc
ccgctggatttccacctgatctttccgcagtggcacgagccggatctgcgcgccatgctg
cgccgcgaccgcaaccatccctccatcatcttgtggagcgtgggcaacgaagtgggcgag
caatacaccggcgaagcgggcgccgcgatcgcgcgcaggctgcacgccatcgtgcacgcc
gaagaccccacgcgcccggcgacggcggcgatgaactacgcctcgcccgagatgccgttg
ccggcggcgctggatgtgatcagcctcaattaccagggcgaaggcatccgcgatacgccc
gagttcgaaggcaccgagcgcatccgcaagctgccgcaatacccggccttccatgccaaa
ttcccgcgcaaggccatcctcagcagcgagacggcctcggcgctgagcagccgcggcgtg
tacctgtttccggtaagtgcgcagagcagcgcgccggtgcgcgatggccgcggcggcgat
tcggtggcccaccaggtcagcgcgtatgaactgcacgcggtggatttcggctccagtgcc
gacaaggtctttgccgcgttggatcggcatccgttcgtggccggcgagtttgtgtggacc
ggcttcgactatctcggcgagcccacgccgtactacagctcacgcagttcctattccggc
attctggatttggctggcttccccaaggaccgctactggctttaccaggcgcgctggcgg
ccggagctgccgatggcgcacctgctgccgcactggagctggccggggcgcgagggccag
gtgacgccggtgcacgtgttcacctctggcgacgaggccgagctcttcgtcaacggcgtc
tcgcaaggccgcaagcgcaaggcgccgttgcagtaccggctgcgctgggatgcggtggtg
taccaaccgggcgagctgcgcgtgcaggcctacaaacatggcaagccgtgggccagcgac
cgtgtgcagaccgccggccgcgccacgcgcatgcagctcagcgccgaccgcagccggatc
cgtggcgatggcaaggacctgagtttcatcaccgtgcgcctgcttgatgccaacgggcgc
cctgcaccgactgcaggcgaccgcctgcggttccgcgtggaaggcgcaggcgaactggtc
gccaccgacaacggtgacccgaccaacctggaggctttcgtcctgcccgagcgcaacgcc
ttcaacggtctgtgcctggtgatcgtgcgcgccaaaccgggcgcgcaggggccgatcacc
gtgcatgtgcaatccgacacgctgcagtccgccagcgtgcaggtgcgggcagaatga

DBGET integrated database retrieval system