KEGG   Xanthomonas citri pv. citri MN11: J163_00240Help
Entry
J163_00240        CDS       T03780                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00010  Glycolysis / Gluconeogenesis
xcr00620  Pyruvate metabolism
xcr01100  Metabolic pathways
xcr01110  Biosynthesis of secondary metabolites
xcr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J163_00240
   00620 Pyruvate metabolism
    J163_00240
Enzymes [BR:xcr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     J163_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJY97990
UniProt: A0A0U5FES8
LinkDB All DBs
Position
151964..153493
Genome map
AA seq 509 aa AA seqDB search
MNALASAKSLNNDPHSIFKPRYDNFIGGQWVAPHSGQYFDNTTPINGKVFTSIARSTAPD
IEAALDAAHAAKDAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDAFMEKALSRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcttgcctctgcaaaatcgctcaacaacgatccgcactccatcttcaaaccg
cgctacgacaacttcatcggcggccagtgggtagcgccgcacagcggccagtacttcgac
aacaccacgccgatcaacggcaaggtctttacctcgatcgcgcgctccaccgccccggat
atcgaagcggcgctggatgccgcgcacgcggccaaggatgcgtggggcaagacctccacc
accgagcgctctaacgtattgctcaagatcgccgaccgcatcgaacagaatctcgaactg
ctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgccgac
gtgccgttatgcgtggaccacttccgctatttcgccggcgccatccgcgcgcaggaaggc
ggcatttccgagatcgacagcgacaccatcgcgtatcacttccacgaaccactgggcgtg
gtggggcagatcatcccgtggaatttcccgctgctgatggcgtgctggaaactcgcaccg
gcgcttgccgccggtaactgcgtggtgatgaagccggcagagcagacgcctgcctcgatc
ctggtgttgatggaactcatcggcgacctgctgccgcctggcgtgttgaacgtggtcaac
ggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagattgcg
ttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggtggcaaatcgcccaacatcttcttcgccgatgtgatggcc
gaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgctttcaaccag
ggcgaagtgtgtacctgcccgtcgcgcgcgctgatccaggagtccatctacgacgccttc
atggaaaaggcgctctcgcgcgtggccgcgatcaagcagggcaatccgctcgaccccaac
accatggtcggtgcgcaagcgtccagcgaacagttggaaaaaatcctctcctatatcgac
atcggcaagcaggaaggcgccgaagtgttgattggcggcgagcgcaacacgctcgatggc
gacctggccgaaggtttttacgtcaagcccacggtgttcaagggccataacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgaagcc
gatgcgctggcgatcgccaacgacacgctgtacggcctgggtgccggtgtctggagtcgc
gacgcttcgcgcctgtatcggatgggccgtgcgatccaggctggccgcgtgtggaccaat
tgctatcacgcctatcctgcgcatgctgcattcggcgggtacaagcagtcgggtatcggc
cgcgagaatcacaagatgatgctcgaccactatcagcagaccaagaacctgttggtgagc
tattcgccgaaggcgctggggtttttctaa

DBGET integrated database retrieval system