KEGG   Xanthomonas citri pv. citri MN11: J163_00478Help
Entry
J163_00478        CDS       T03780                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00564  Glycerophospholipid metabolism
xcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    J163_00478
Enzymes [BR:xcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     J163_00478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJY98228
UniProt: A0A0U5GFI1
LinkDB All DBs
Position
complement(429452..430966)
Genome map
AA seq 504 aa AA seqDB search
MGEMYDLLVIGGGINGVGIARDAAGRGLSVCLCEQDDLAAHTSSASTKLIHGGLRYLEQY
EFALVGKALAEREVLLRLAPHIIWPLRFLLPHQPHLRPAWMIRAGLFLYDHLGGSKRSLP
RSRRLSLRTHPVGAPLQESLRTGFVYSDAWVQDARLVVLNAMDAARRGAKIHTRTRCVGA
WRDAGFWYAELEDRQGRRRTVQARALANAAGPWAVSFLDTVASVPHEHALRLVKGSHIVV
PKLFDHDHAYIFQQPDRRIVFAIPYEHDFTLIGTTDVDYEADPAAPKIDAAEVQYLCDAV
NLYFQQQISPADVVWNYSGVRPLLDDAEDNAAEVTRDYQLEVVTEGAPLLNVFGGKLTTY
RKLAEEAVDRLTHALGTRKPAWTARGEALPGGEQRDIASLLERVGRARPWLPAATAQRLV
RNYGTCAEHLLGDAQSLTDLGTHFGADLYQAEVDYLRQHEWAVAADDILWRRSKLGLRID
AAGRQRLEDYLQTQSIRQRDVVSA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatgtacgatcttctggtaatcggcggcggcatcaacggggtgggcattgcc
cgtgatgcggccgggcgcggtctgtcggtgtgcctgtgcgagcaggacgacctggctgcg
cacaccagcagcgccagcaccaaactcattcacggcggcctgcgctacctggagcagtac
gaattcgccttggtcggcaaagcactggccgagcgcgaagtgttgctgcggctggccccg
cacatcatctggccgttgcgcttcctgctgccccaccaaccgcacctgcgcccggcatgg
atgatccgcgccgggctgttcctgtacgaccatctgggcggcagcaagcgcagcctgccg
cgctcgcgccggctgtcgctgcggacgcacccggtcggtgcgccgctgcaggagtcgctg
cgcaccggcttcgtgtattcggatgcgtgggtgcaggacgcgcgactggtggtgctcaac
gcgatggacgccgccaggcgcggtgccaagatccacacccgcacgcgctgtgtcggtgcc
tggcgcgatgcgggcttctggtatgccgagctcgaagaccgccagggccgccgccgcacc
gtgcaggcgcgtgcgctcgccaatgccgccggcccgtgggcggtgtcgttcctggacacc
gtggcctcggtgccgcacgaacatgcattgcggctggtcaagggcagccacatcgtggtg
cccaagctgttcgatcacgaccatgcgtacatcttccagcaaccggaccggcgcatcgtg
ttcgccatcccctacgagcacgacttcaccttgatcggcaccaccgacgtggactacgaa
gccgaccccgccgcgccgaagatcgatgcggccgaagtgcaatacctgtgcgatgcggtg
aacctgtatttccagcagcagatctcccccgccgatgtggtgtggaattacagcggcgtg
cggccgttgctggacgatgccgaagacaacgcagccgaagtgacccgcgattaccagctg
gaagtggtcaccgagggcgcgccgttgctcaacgtgttcggcggcaagctgaccacctat
cgcaagctcgccgaagaggcagtggaccggcttacccacgcgctgggcacacgcaagcct
gcgtggaccgcgcgtggcgaggcattaccaggcggcgagcagcgcgatatcgccagcctg
ctggaacgcgtcggccgcgcgcgcccctggctaccggcagcgaccgcgcagcggctggtg
cgcaactacggcacctgcgccgaacacctgcttggcgatgcgcagagcctgaccgatctg
ggcacgcacttcggcgcggacctgtatcaggccgaggtggattacctgcgccaacacgaa
tgggcggtggcggccgacgatatcctgtggcggcgcagcaagctcggcctgcggatcgat
gcggccgggcggcagcgcctggaagactatctgcagacgcagtcgatccggcaacgcgac
gtcgtttctgcttga

DBGET integrated database retrieval system