KEGG   Xanthomonas citri pv. citri MN11: J163_02620Help
Entry
J163_02620        CDS       T03780                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J163_02620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcr02000]
    J163_02620
Enzymes [BR:xcr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     J163_02620
Transporters [BR:xcr02000]
 Other Transporters
  Pores ion channels [TC:1]
   J163_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJZ00318
UniProt: A0A0U5FEJ2
LinkDB All DBs
Position
2851829..2852473
Genome map
AA seq 214 aa AA seqDB search
MSDDRHVTLFHNPRSRSRGVLVLLEELGARYRLQPIDLEKEQQRTPEFLAINPMGKIPTI
VHGTSVVTEQGAIYQYLAELYPEAGLSPAPGDTDRGAYLRWLAFYGSAFEPAIIDLALKR
SAPPRSLSPYADADTVLQVVDAQLAKGDYLLGERCSAADVLWGGALAWMVEFGLIDPPAP
TRAYIARMVARPAVARAEAVDAGRAPADGASASG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaccgccacgtcaccctcttccacaacccccgctcccgctcgcgcggagtg
ctggtcttgctggaagaactgggcgcacgctaccgcctgcagcccatcgatctggaaaag
gagcagcagcgcacgccggaattccttgcgatcaacccgatgggcaagattccaaccatt
gttcatggcaccagcgtggtcaccgaacagggcgccatctatcagtacctggccgagctg
tatccggaagccggtctgtcgccggcgccgggcgataccgaccgtggcgcctacctgcgc
tggcttgcgttctacggctctgccttcgagccggcgatcatcgatcttgcgctcaagcgc
agcgccccgccgcgctcgctctcgccttatgccgacgccgacaccgtgctgcaggtggtg
gatgcgcagctggccaagggcgattacctgctgggcgagcgctgcagtgcggccgatgtg
ctgtggggcggcgccttggcgtggatggtggagtttggcctgatcgatccgcccgccccg
acccgcgcctatatcgcccggatggtcgcgcgcccggcggtggcgcgcgccgaagccgtc
gacgccgggcgcgcgcccgcggacggcgccagcgcaagcgggtaa

DBGET integrated database retrieval system