Xanthomonas citri pv. citri MN11: J163_03811 Help Entry J163_03811        CDS       T03780                                  Name (GenBank) ATP synthase, F0 subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism xcr  Xanthomonas citri pv. citri MN11 Pathway xcr00190   Oxidative phosphorylation xcr01100   Metabolic pathways Module xcr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:xcr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     J163_03811  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:xcr00194]     J163_03811 Photosynthesis proteins [BR:xcr00194]  Photosystem and electron transport system   F-type ATPase [OT]    J163_03811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF751 Motif Other DBs NCBI-ProteinID:  AJZ01496 UniProt:  A0A0U5FN07 LinkDB All DBs Position complement(4308187..4308489) Genome browser AA seq 100 aa AA seqDB search MYLAVLTNLAQVQSSTVLAVGIMIGLAALGAGLGLAIMAGKFLESAARQPELIPVLQVRM FITAGLIDAAFIISVAVGLLFAFANPLAQVFIERLSQAAG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtacctcgccgtcctgaccaacctcgctcaagtccagagctccaccgtcctcgccgtc ggcatcatgatcggcctggccgcgctgggtgccggcctcggtctggccatcatggctggc aagttcctggaatcggctgcgcgccagccggagctgatcccggtgctgcaggttcgtatg ttcatcaccgccggcctgatcgacgccgcgttcatcatcagcgtcgctgtcggcctgctg ttcgccttcgccaacccgctggcccaggtgttcatcgagcgtctgtcgcaggctgccggc tga

DBGET integrated database retrieval system