KEGG   Xanthomonas citri pv. citri MN11: J163_04381Help
Entry
J163_04381        CDS       T03780                                 

Definition
(GenBank) Beta-galactosidase/beta-glucuronidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
xcr  Xanthomonas citri pv. citri MN11
Pathway
xcr00052  Galactose metabolism
xcr00511  Other glycan degradation
xcr00600  Sphingolipid metabolism
xcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    J163_04381
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    J163_04381
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    J163_04381
Enzymes [BR:xcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     J163_04381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AJZ02056
UniProt: A0A2U2FGW9
LinkDB All DBs
Position
complement(4962870..4965539)
Genome map
AA seq 889 aa AA seqDB search
MAAPHPASDASRERISLNAQWRFHRGDPPANQEILDYDVRPQVVRSDDGKVADAQPEQAQ
LTDASAVRVLKPWILPTANGLIADPAQRHTRPPGNPGSTVAYVQPHFDDSAWETVDLPHD
WAIAGPFLANGPYGGMGRLPSWGIGWYRKSLDIPASDRGRALFLDLDGAMSYATVWLNGT
LVGGWPYGYSSWRVDLTPYVIAGKRNQLVIRLDNPPESARWYPGGGLYRNVWLTKTAPLH
IAHWGTQLTTPHVSADAAQVQLTVTLDNAARSATQAQVSTAIYLLDDASDRPSGEAVARI
PAQPIAVPAGGTAHVQGSTRIDAPRLWGPPPTQQPHRYVAITEVGQQGHVVDRYETRFGI
RSIVFDADRGLLVNGEHVPIRGVNNHHDLGALGAAFNRRAAERQLQLLQQMGANAIRMSH
NPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLVFPQWHATDLRAMLRRDRNHPSV
MLWSVGNEVGEQYTGEQGAAIARALRAIVHAEDPTRPAAVAMNYASPEMPLSAALDVVSL
NYQGEGIRDAAEFEGTQRIRKPPQYPAFHARFPHKAIVSSETASALSSRGVYLFPVTPDN
SAPVRDGRGGDSAAHQVSAYELHAVDFGSSADKVFAALDRHPYVAGEFVWTGFDYLGEPT
PYYSSRSSYSGIFDLAGFPKDRYWLYQSRWRPELPVAHLLPHWSWPGREGQVTPVHVFTS
GDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELQMQAYKDGKPWASERVQTAGRAA
RMQLMPDRGSIRGDGQDLSFITVRLLDRDGRPAPTAGDRLRFRIEGPGELVATDNGDPTN
LETFASSQRHAFNGLCLAIVRAKAGARGTITVHVESDTLQAAQTQVAVQ
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaccgcacccggccagcgacgcctcgcgcgaacgtatttcgctcaatgcgcag
tggcgctttcatcgtggcgacccacccgcaaaccaggaaatcctggactacgatgtgcgc
ccgcaggtggtgcgcagcgatgacggcaaggtggccgatgcgcaaccggagcaagcgcag
ctcaccgatgcgtccgccgtgcgcgtgctcaagccgtggatcctgcccaccgccaacggc
ttgatcgcagacccggcccagcggcacacgcgccccccaggcaacccgggcagcacggtg
gcttatgtgcagccgcacttcgacgacagcgcatgggaaaccgtggacctgccacatgac
tgggccattgccgggccgttcctggcaaatgggccttacggtggcatgggccggttgccg
agctggggcattggctggtatcgcaagagcctggacatcccagccagcgatcgcggccgc
gcgttgtttctggatctcgatggtgcgatgtcttacgccacggtctggctcaacggcacc
cttgtcggcggatggccttacgggtacagctcctggcgcgtggatctgacgccgtatgtg
attgcaggtaagcgcaatcaactggtcattcgcctggacaacccgcccgaatcggcgcgt
tggtatccgggcggcgggctgtatcgcaacgtgtggctgaccaaaacggcgccgttgcat
atcgcgcattggggcacgcagctgaccacgccgcacgtttcggccgatgcggcgcaggtg
cagctgaccgtcacgctggacaacgccgcccgcagcgccacccaggcgcaggtgagcaca
gcgatctatctgctcgacgatgcaagcgaccggcccagcggcgaggcggtcgcgcgcatt
ccagcgcagcccatcgcggtccctgccggcggcaccgcgcacgtgcaaggcagtacccgg
atcgacgccccgcgcctgtgggggcctccacccacgcagcaaccgcatcgctatgtggcc
atcaccgaggttggccagcaggggcacgtggtggaccgctacgaaacccgcttcggcatt
cgcagcatcgtgttcgacgccgacaggggcctactggtcaatggcgagcacgtgccgatc
cgcggggtgaacaatcatcacgacctgggcgcgctcggtgcggcgttcaacagacgcgcc
gccgagcggcagttgcaattgctgcagcagatgggcgccaatgccattcgcatgagccat
aacccgcctgcgcccgagttgctcgagctgaccgaccgcatgggcctgctggtggtggat
gaggtgttcgacagttgggagatgaagaagaccccgctggatttccatctggtgtttccg
cagtggcatgccaccgatctgcgcgcgatgctgcgccgcgaccgcaatcatccttcggtg
atgctatggagcgtgggcaacgaggttggcgagcaatacaccggcgaacagggcgcggcg
attgcgcgcgcgctgcgcgccatcgtgcatgcagaagacccgacgcgcccggccgcggtg
gcgatgaactacgcctcgcccgagatgccgttgtccgccgcgctggatgtcgtcagcctc
aattaccagggggaaggcatccgcgatgcagccgagttcgagggcacgcagcgcatccgt
aagccgccgcaatacccggcgtttcatgcacggtttccgcacaaggccatcgtcagcagc
gagactgcctcggcactgagcagtcgtggcgtgtatctgtttccggttactccggacaac
agcgcgccggtacgcgatggccgtggcggcgattcggcggcgcatcaggtcagcgcgtac
gagctgcatgccgtggatttcggctccagtgccgacaaggtgttcgctgcgttggatcga
cacccgtacgtcgccggcgagttcgtctggaccgggttcgattacctgggcgagcccacc
ccgtattacagctcgcgcagttcctactcgggcatcttcgatctggccggctttccgaag
gaccgttactggctctatcaatcgcgctggcgcccggaattgccggtggcgcatctgctg
ccgcattggagctggccagggcgcgagggacaggtcacgcccgtgcatgtgttcacctcc
ggcgacgaggccgaactgttcgtcaatggcgtctcgcaggggcgcaagcgcaaggcgcca
ctgcagtaccggctacgctgggacgcggtggtgtaccagccgggcgaattgcagatgcag
gcgtacaaggatggcaagccgtgggccagcgagcgcgtgcagacagcaggccgcgccgcg
cgcatgcagctgatgccagatcggggcagtatccgcggcgacggacaggacctgagtttc
atcaccgtgcgcctgctcgatcgcgacggacgtcctgcgccgaccgcgggcgaccgcctg
cgcttccgcatcgaaggcccgggcgagttggtggccaccgacaacggcgatcccaccaat
ctggaaacattcgcctcttcgcagcgtcatgccttcaacgggctgtgcctggcgatcgtg
cgtgccaaggccggggcgcgtggcacgatcaccgtgcatgtggaatcggacacgttgcaa
gccgcacagacacaggtggcggtgcagtga

DBGET integrated database retrieval system