KEGG   Xanthomonas citri subsp. citri A306: J151_01556Help
Entry
J151_01556        CDS       T03584                                 

Definition
(GenBank) 3-hydroxyacyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
xct  Xanthomonas citri subsp. citri A306
Pathway
xct00061  Fatty acid biosynthesis
xct00780  Biotin metabolism
xct01100  Metabolic pathways
xct01212  Fatty acid metabolism
Module
xct_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:xct00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    J151_01556
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    J151_01556
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xct01004]
    J151_01556
Enzymes [BR:xct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     J151_01556
Lipid biosynthesis proteins [BR:xct01004]
 Fatty acid synthase
  Component type
   J151_01556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AJD68002
LinkDB All DBs
Position
complement(1624652..1625110)
Genome map
AA seq 152 aa AA seqDB search
MSHHVYELPIDVSQIQTLLPHRYPFLLVDRILELDLETKWIVAQKNVSINEPFFQGHFPN
RPVMPGVLIIEALAQVGGVMTQLGLGRDALSQLFYMVKVDKARFNKQVVPGDVLIMEVQM
KRLIRNVGCFYGEAKVDGEVVASAEVMCAGAR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccacgtttacgaactgccgatcgacgtcagtcagatccagacgctgctcccg
caccgttacccgtttctgctggtcgaccgcatcctcgaactcgatcttgaaaccaagtgg
atcgtggcgcagaagaacgtcagcatcaacgagccgttcttccagggccattttccgaac
cgtccggtcatgcctggcgtgctgatcatcgaggcgctggcgcaggtcggcggcgtaatg
acccagctcggcctgggccgcgatgccttgtcgcagctgttctatatggtcaaggtggac
aaggcccgcttcaacaagcaggtggtgccgggcgacgtgttgatcatggaagtgcagatg
aagcgcctgatccgcaacgtgggatgcttctacggcgaagccaaggtcgatggcgaagtg
gtggccagtgccgaggtgatgtgcgccggcgccaggtaa

DBGET integrated database retrieval system