KEGG   Xanthomonas citri subsp. citri A306: J151_02636Help
Entry
J151_02636        CDS       T03584                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xct  Xanthomonas citri subsp. citri A306
Pathway
xct00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J151_02636
Enzymes [BR:xct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     J151_02636
Transporters [BR:xct02000]
 Other Transporters
  Pores ion channels [TC:1]
   J151_02636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AJD69055
LinkDB All DBs
Position
2864302..2864946
Genome map
AA seq 214 aa AA seqDB search
MSDDRHVTLFHNPRSRSRGVLVLLEELGARYRLQPIDLEKEQQRTPEFLAINPMGKIPTI
VHGTSVVTEQGAIYQYLAELYPEAGLSPAPGDTDRGAYLRWLAFYGSAFEPAIIDLALKR
SAPPRSLSPYADADTVLQVVDAQLAKGDYLLGERCSAADVLWGGALAWMVEFGLIDPPAP
TRAYIARMVARPAVARAEAVDAGRAPADGASASG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaccgccacgtcaccctcttccacaacccccgctcccgctcgcgcggagtg
ctggtcttgctggaagaactgggcgcacgctaccgcctgcagcccatcgatctggaaaag
gagcagcagcgcacgccggaattccttgcgatcaacccgatgggcaagattccaaccatt
gttcatggcaccagcgtggtcaccgaacagggcgccatctatcagtacctggccgagctg
tatccggaagccggtctgtcgccggcgccgggcgataccgaccgtggcgcctacctgcgc
tggcttgcgttctacggctctgccttcgagccggcgatcatcgatcttgcgctcaagcgc
agcgccccgccgcgctcgctctcgccttatgccgacgccgacaccgtgctgcaggtggtg
gatgcgcagctggccaagggcgattacctgctgggcgagcgctgcagtgcggccgatgtg
ctgtggggcggcgccttggcgtggatggtggagtttggcctgatcgatccgcccgccccg
acccgcgcctatatcgcccggatggtcgcgcgcccggcggtggcgcgcgccgaagccgtc
gacgccgggcgcgcgcccgcggacggcgccagcgcaagcgggtaa

DBGET integrated database retrieval system