KEGG   Xanthomonas citri pv. citri UI7: J159_03781Help
Entry
J159_03781        CDS       T03733                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
xcu  Xanthomonas citri pv. citri UI7
Pathway
xcu00061  Fatty acid biosynthesis
xcu01100  Metabolic pathways
xcu01212  Fatty acid metabolism
Module
xcu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:xcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    J159_03781
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xcu01004]
    J159_03781
Enzymes [BR:xcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     J159_03781
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     J159_03781
Lipid biosynthesis proteins [BR:xcu01004]
 Fatty acid synthase
  Component type
   J159_03781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AJY83724
LinkDB All DBs
Position
4273518..4274033
Genome map
AA seq 171 aa AA seqDB search
MTRQSTYSRDQLLASARGELFAPDSGRLPNDPMLMFDRITEISNTGGAHGKGVIRAELDI
RPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWIGAPGRGRALGCGEVKFTGQVLPS
ARLVRYEIDVSRVINRKLVMAQTDARMLVDGREIYTAKDLRVGMFTSTENF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcaaagtacgtactcgcgtgaccaattgctggccagcgcgcgtggggaattg
tttgcgcccgacagtggccgtctgcccaatgatccgatgctgatgttcgaccgcattacc
gagatcagcaacaccggcggcgcacatggcaagggcgtgattcgtgccgaactggatatc
cgccctgacctatggttcttcggctgccacttcatcggcgacccggtgatgccaggctgc
ctgggcctggatgcgatgtggcagctcaccggctttttcctcacctggatcggcgcgccg
ggccgtggccgcgcattgggctgcggcgaggtcaagttcaccggccaggtgctgcccagc
gccaggctggtgcgctacgagatcgatgtcagccgcgtcatcaaccgcaagctggtgatg
gcgcagaccgatgcacgcatgctggtggatgggcgcgagatctacaccgccaaggatctg
cgtgtgggcatgttcacttcaacggagaatttctga

DBGET integrated database retrieval system