KEGG   Xanthomonas citri pv. citri UI7: J159_03782Help
Entry
J159_03782        CDS       T03733                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
xcu  Xanthomonas citri pv. citri UI7
Pathway
xcu00061  Fatty acid biosynthesis
xcu00780  Biotin metabolism
xcu01100  Metabolic pathways
xcu01212  Fatty acid metabolism
Module
xcu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:xcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    J159_03782
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    J159_03782
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xcu01004]
    J159_03782
Enzymes [BR:xcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     J159_03782
Lipid biosynthesis proteins [BR:xcu01004]
 Fatty acid synthase
  Component type
   J159_03782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AJY83725
LinkDB All DBs
Position
4274033..4275241
Genome map
AA seq 402 aa AA seqDB search
MRRVVITGMGITSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVALDLDSLI
DRKLKRFMGDASAYAYLAMRDAIADAGLDAELVSGLRTGVIAGSGGGSSQWQVETADLLR
NRGVRKVGPYMVPRTMCSSVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGAQ
DVMFAGGGEELHWTMSVMFDAMGALSTGSNDRPAVASRPYDAQRDGFVIGSGGGMLVLED
YDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMRMAMQGLQRPIDYLNTHGTST
PLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAIYSLLMLRDGFMAGSAHID
DLDPRAEGFPILRQTQDATLNTVMSNSFGFGGTNAALVFGRT
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgtcgtcattaccggaatgggcatcacctcatgcctgggcaacgatctggac
accgtctccagcgcattgcgcgagagccgctctggcatcaccgcgctgcccgatcacgcc
gaagcaggcctgcgtagccaggtcggcggtgcggtggcgctggatctggacagcctgatc
gaccgtaagctcaaacgcttcatgggcgatgcctcggcctacgcgtacttggcaatgcgc
gacgcgatcgccgatgcgggcctggatgccgagctggtcagcggcctgcgtaccggcgtg
attgccggctccggtggcggctccagccaatggcaggtggaaaccgccgatctgctgcgc
aaccgtggcgtgcgcaaggtgggcccatacatggtgccgcgcacgatgtgttcgtcagtg
tccgcatcgctagccactgcgttcaaaatacgcggactgagctactcgctgtcggccgcg
tgcgcgacgtctgcgcattgcatcggtgcggcggcagatctgatccggcatggcgcacag
gacgtgatgttcgccggtggcggcgaagaactgcactggacgatgagcgtgatgttcgat
gcgatgggcgcgctgtccaccggttccaacgatcgccccgccgtggcctcgcgcccgtac
gatgcgcagcgcgatggcttcgtcatcggcagcggcggcggcatgctggtgctggaagac
tacgatcacgccatcgcacgcggcgcacgcatccatgccgaactgctcggctatggcgtg
acctccgacggtgccgacatggtcgcgcccagcggcgaaggcgccgtgcgctgcatgcga
atggccatgcaggggctgcagcgtcccatcgattacctcaacacgcatggcacgtccacg
ccgctgggcgatgtcaccgaactgggcgcggtgcgcgaggtattcggcgacaacgtgccg
ccgctgtcttcgaccaaggggctctccgggcactcgctgggcgcggccagcgtgcacgag
gcgatctacagcctgctgatgctgcgcgatggcttcatggccggctcggcgcatatcgac
gacctcgatccgcgcgccgaaggctttcccatcttgcggcagacgcaggacgcgaccttg
aacacggtgatgtccaacagtttcggctttggtggcaccaacgcggcactggtcttcggg
cgaacctaa

DBGET integrated database retrieval system