KEGG   Xanthomonas campestris pv. vesicatoria: XCV0036
Entry
XCV0036           CDS       T00288                                 

Gene name
gltD
Definition
(GenBank) glutamate synthase, beta subunit
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00250  Alanine, aspartate and glutamate metabolism
xcv00910  Nitrogen metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    XCV0036 (gltD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XCV0036 (gltD)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     XCV0036 (gltD)
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 2-Hacid_dh_C NAD_binding_7 HI0933_like FAD_binding_3 AlaDh_PNT_C FMO-like FAD_oxidored Thi4 FAD_binding_2 GIDA DAO Amino_oxidase Lycopene_cycl 3HCDH_N NAD_binding_9 zf-HIT Oxidored_nitro
Other DBs
NCBI-ProteinID: CAJ21667
UniProt: Q3BZP6
LinkDB
Position
complement(38809..40290)
AA seq 493 aa
MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGKFDKADAQYQAGRCLDCGNPYCSWK
CPVHNAIPQWLQLVQENRIEEAAALCHSTNPLPEVCGRVCPQDRLCEGSCTLEEFGAVTI
GAVEKYIVDTAFKMGWRPDLGNVQPTGHRVAVIGAGPAGLACADRLARAGIEAVVYDRYE
QIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEIGKDVSIEQLLGEYDAVFLGT
GAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRPIAGWEDQLALPDLSGKRVV
VLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSAREVANAREEGVRFLFNRQPLSI
ESGADDEAIGVTVVETRLGEPDASGRRNAVPVEGSESLLEADVVIIAFGFSPTLPDWLAS
QGVEAGSNGRIVAPADCNGRLPYQTSNPRLFAGGDCVRGADLVVTAVAEGRDAAGSIVQL
LGVNAQVKEPAAA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgagccgcaagcaagccttccaattcctcgacctgccccggaccatgcccacgcgcatt
ccggtggaactgcgcacctccggcgactggggcgagttgtacggcaagttcgacaaggcc
gatgcgcaataccaggccggccgttgcctggactgcggcaatccgtattgcagctggaaa
tgcccggtacacaacgccatcccgcagtggctgcagctggtgcaggaaaaccgcatcgag
gaagccgccgcgctatgccattccaccaacccgctgccggaagtgtgcgggcgggtgtgt
ccgcaggaccgcctgtgcgaaggcagctgcacgctggaggaattcggcgcagtcaccatc
ggcgcggtggagaagtacatcgtcgacaccgccttcaagatgggctggcgcccggacctg
ggcaacgtgcagccgaccggccaccgcgtggcggtgatcggcgccggcccggctgggctg
gcgtgtgcggaccggctggcgcgtgccggcatcgaggcggtggtctacgaccgctatgag
cagatcggcgggctgctgcagttcggcatccccagcttcaagctggacaagtcggtgatc
ggcaagcgccgcgagatcctcgaaggcatgggcgtgcagttccgcctgggcgtggagatc
ggtaaggacgtcagcatcgagcagttgctgggcgaatacgatgcggtgttcttagggacc
ggcgcctatcgctacaccgacggcggcctgcccgggcaagacctgaagaacgtgctgccg
gcgctgccgttcctggtgcagaacagccgcatcgtcagcggcaacgacccgcacggccgg
ccgatcgccggctgggaagaccagctcgccctgcccgacctcagcggcaagcgcgtggtg
gtgctgggcggcggcgataccggcatggactgcgtgcgcagcgccattcgcctgggcgcg
gccaaggtcacctgcgcctaccgccgcgacgaagccagcatgcccggctcggcgcgcgag
gtggccaacgcgcgcgaagaaggcgtgcgctttttgttcaaccgccagccgctgtcgatc
gaatccggcgccgacgacgaagccatcggcgtgaccgtggtggaaaccagattaggtgag
cccgatgccagcggccgccgcaatgccgtgccggtggaaggcagcgaatcgctgctggaa
gcggacgtggtgatcatcgccttcggcttctcgcccaccctgcccgattggttggcctcg
caaggcgtggaagccggcagcaacggccgcattgtcgccccggccgactgcaacggccgc
ctgccctaccagaccagcaacccccgcctgttcgccggcggcgactgcgtgcgcggtgcg
gacctggtggtcaccgcagtggccgaaggccgcgatgcggcgggaagcatcgtgcagctg
ctgggggtgaacgcgcaggtcaaggagccggctgcggcgtga

DBGET integrated database retrieval system