KEGG   Xanthomonas campestris pv. vesicatoria: XCV0105Help
Entry
XCV0105           CDS       T00288                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00620  Pyruvate metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV0105
   00620 Pyruvate metabolism
    XCV0105
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XCV0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CAJ21736
UniProt: Q3BZH7
LinkDB All DBs
Position
122773..124302
Genome map
AA seq 509 aa AA seqDB search
MNAQPATKPLNTDPQSIFKPRYDNFIGGKWVAPKDGQYFDNTTPINGKVFTSIARSTAPD
IEAALDAAHAAKEAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDRFMEKALARVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAQVLIGGERNTLEGDLAGGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGLWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGLF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcaacctgccaccaagccgctcaacaccgatccgcagtcgatcttcaaaccg
cgctacgacaacttcatcggcggcaagtgggtcgcgccgaaggatggtcagtatttcgac
aacaccacgccgatcaacggcaaggtctttacctcgatcgcgcgctccaccgctccggat
atcgaagcggcgctggatgctgcgcacgcggccaaggaggcgtggggcaagacctccacc
accgagcgctctaacgtactgctcaagatcgccgaccgcatcgaacagaatctcgaactg
ctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgccgac
gtgccattgtgcgtggaccacttccgctatttcgccggtgccatccgcgcgcaggaaggc
ggtatttccgagatcgacagcgacaccatcgcgtatcacttccacgaaccgttgggcgtg
gtggggcagatcattccgtggaatttcccgctgctgatggcgtgctggaaactcgcgccg
gcgcttgccgccggcaactgcgtggtgatgaagccggcagagcagacgccggcttcgatt
ttggtgttgatggaactcatcggcgacctgctgccgcctggcgtgttgaacgtggtcaac
ggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagattgcg
ttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggtggcaaatcgcccaacatcttcttcgccgatgtgatggcc
gaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgccttcaatcaa
ggcgaagtgtgtacctgcccgtcgcgcgcgctgatccaggaatccatctacgacaggttc
atggaaaaggcgcttgcgcgcgtggcggcgatcaagcagggcaatccgctcgatcccaac
accatggtcggtgcgcaggcgtccagtgagcagctggaaaaaattctctcctacatcgat
atcggcaagcaggaaggtgcgcaagtgctgatcggcggcgagcgcaacacgctcgagggc
gacctggccgggggcttttacgtcaagcccacggtgttcaaggggcacaacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgaagcc
gacgcgctggcgatcgccaacgacacgctatacggcctgggtgccggcctctggagtcgc
gacgcttcgcgcctgtatcggatgggccgcgcgatccaggctggccgcgtgtggaccaac
tgctatcacgcctacccggcgcatgctgcatttggcgggtacaagcagtcgggcatcggc
cgcgaaaaccacaagatgatgctcgaccactatcaacagaccaagaacctgttggtgagc
tattcgccgaaggcgctggggcttttctaa

DBGET integrated database retrieval system