KEGG   Xanthomonas campestris pv. vesicatoria: XCV0647
Entry
XCV0647           CDS       T00288                                 

Definition
(GenBank) putative thioredoxin reductase
Organism
xcv  Xanthomonas campestris pv. vesicatoria
SSDB
Motif
Pfam: Pyr_redox_2 GIDA HI0933_like DAO FAD_oxidored FAD_binding_2 NAD_binding_8 NAD_binding_9 Pyr_redox_3 FAD_binding_3 Lycopene_cycl Pyr_redox Zn_Tnp_IS1595
Other DBs
NCBI-ProteinID: CAJ22278
UniProt: Q3BXY5
LinkDB
Position
731708..732607
AA seq 299 aa
MQHEVIIVGGSYAGLSAALQLARARRRVLLVDSGRRCNRFAETSHGLLGRDGASPARIAD
EARAQVLSYSSVQWADGEVVQVRGQAEAFEVVFADGSVHATRRLILAMGVVDRLPALAGL
AERWGRQVFVCPYCHGYELQQGRIGVIATSALAAHQAAMLPDWGPTWLFLNDTLVPDESQ
RAQLETRAVHVVTGAVAALQGEGDALELVLHDGQRFALDGVFITTQTEISPLVRQLGCAT
SEGPFGRLLAVDAMQATTVPGVFACGDIVNPAASVVLAAASGAMAGVATHRSLIFGLGS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcagcacgaggtgatcatcgttggcggcagttatgcagggctgtcagccgccttgcag
ttggcgcgggcgcgacgccgcgtcttgctggtggacagcggccggcggtgcaatcgtttt
gccgaaacctcgcatggcttgctgggccgcgatggcgcatcgcccgcgcgcatcgccgat
gaggcgcgtgcgcaggtgctgtcgtattccagcgtgcagtgggctgatggcgaggtcgtc
caggtccgcgggcaggcggaggcgttcgaggtcgtctttgccgatggcagcgtgcatgcc
acccgccggctgattctggccatgggggtggtcgatcgtctccctgcgctggccggtctg
gccgaacgttggggcaggcaggtgttcgtgtgtccgtattgccatggctacgaactgcag
caggggcgcatcggtgtgatcgcgacctctgcgcttgctgcgcatcaagccgccatgctg
ccggattggggccctacttggctgttcttgaacgacacgctggtgccggacgaatcccag
cgggcgcaactggagacgcgcgcggtgcatgtggtgaccggcgcagtggcggcgctgcaa
ggcgagggcgatgcgctggagctggtgctgcacgacggccagaggttcgcgttggacggg
gtgttcatcaccacccagaccgagatcagcccgttggtgaggcagcttggatgtgccacc
agcgaggggcctttcggtcgccttctcgctgtggacgccatgcaggcaacgacggtgccg
ggcgtatttgcctgtggcgatatcgtaaacccggccgcatcggtggtgttggcggcagcc
agcggcgcgatggccggcgttgcaacgcatcgcagcctgatcttcggcctgggtagctga

DBGET integrated database retrieval system