KEGG   Xanthomonas campestris pv. vesicatoria: XCV0825Help
Entry
XCV0825           CDS       T00288                                 

Gene name
ftsI
Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00550  Peptidoglycan biosynthesis
xcv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XCV0825 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XCV0825 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xcv01011]
    XCV0825 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xcv03036]
    XCV0825 (ftsI)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XCV0825 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:xcv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   XCV0825 (ftsI)
Chromosome and associated proteins [BR:xcv03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    XCV0825 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer MttA_Hcf106 PetG
Motif
Other DBs
NCBI-ProteinID: CAJ22456
UniProt: Q3BXF7
LinkDB All DBs
Position
938527..940395
Genome map
AA seq 622 aa AA seqDB search
MKTGRNRPRSNFNLRGRLTLVGIALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLRELP
IATSRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQK
AGKEFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEG
LELAFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRN
ALVENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMK
PLTVATALTAGVVTKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKI
AAKVPDQTFYHSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQ
IAQAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETVVTQGGAKGAAILGY
HVAGKTGTARKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKVYYGGLVSAPV
FHRVMEGALRLMDVPPDDIQSWLAAQAAGKTGQPVVKPQSADPDPALVPDPVDEVSAGIP
TALAPAPAAAPAQPAPLQESRQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccggccgcaaccgcccccgtagcaatttcaacctccgtggtcgcctgaccctg
gtcggtatcgcgcttggcctgtgctcggtgacgctgatcggccgcgcggcttatgtgcaa
ctggtcaatcgcgatttttaccagcgtcagggcgaagcgcgttacctgcgcgaactgccc
atcgccacctcgcgcggcatgatcaccgaccgcaacggcgagccgctggcggtgtccacg
ccggtggaatcgatctgggtcaatccgcaggaactgctgcgcaacccggaccgcattccc
gagctggcaaaagcgctcgggcagccgctggacgagttgaacgccaagctggcacagaag
gccggcaaggaattcatgtacctgcagcgccggatcaatccggacaaggcgcatgcgatt
gtcgatctgaagattcctggcgtgttctcgcagcgcgagttccgccgcttctatccgcaa
ggcgaggcgatggcccatgtgctgggcttcaccaacatcgacgaccgcggccaggaaggc
ctggagctggcattcgacgaatggctgcgcggcaagcccggttccaagaaagtggtgcgc
gatgcgcgcggcgccatcgtggaaagcgtggacctggtgcgtccggcgcaaccgggcaag
gatctgacgctgagcatcgaccgccgcatccagttcctggcctacaaggagctgcgcaac
gcactggtcgaaaacaacgcggccggcggttcgatggtggtgatggacgtggccaccggc
gaagtgctggcgatggtcaacctgcctacctacaaccccaattcggtcaccggcatcaat
ccgtcggcgcgccgcaaccgtgcggtcaccgatctggtcgagccgggttcgacgatgaag
ccgctgaccgtggccaccgcgctgacggccggcgtggtgaccaaggacaccgtcatcgat
accaaccccggctacatgtcggtggggcgtttcaccattcgcgatgtgccgcgcaacaac
ggtgtgctcaacgtcaccggcgtgatcacccgcagttcgaacatcggcgcggccaagatc
gcggccaaggtgcccgaccagaccttctaccactcgatccgcaacttcggttacggcagc
gcgccgcatagcgggttccccggcgaatcggccggcgtggtgctgcagccggcgcgctgg
agcggcccgtccaagaccacgatgtcctacggttacggcctgtcggtgacgccgctgcag
attgcccaggcgtacgccacgctgggcaacggcggcaagctcactccgccgaccttcgtg
cgtggccagcacaacgaaacccgtcaggtgatcacgccggaagtggcgcgccaggtcatc
gacatgatggagaccgtggtgacccagggcggtgccaagggcgcggcgattctgggctac
cacgtggccggcaagaccggcacggcgcgcaagaatggcgccaacggctacgagcgcggg
cattacaacgccctgttcgccggcctggtgccggccacgcgcccgcgctttgccaccgtc
atcgtgatcaacgatccgcaaggcaaggtgtattacggtggtctggtatcggcgccggtc
ttccatcgcgtgatggaaggcgcgctgcgcttgatggacgtgccgccggacgatatccag
tcgtggctggccgcacaggcggccggcaagaccggccagccggtggtcaagccgcaatcg
gccgatccggatccggccctggtgccggacccggtggatgaagtctctgccggcattccg
accgcactggcgcctgcgccggctgccgcgccagcacagcccgcgccgttgcaggagagc
cgccagtga

DBGET integrated database retrieval system