KEGG   Xanthomonas campestris pv. vesicatoria: XCV0858Help
Entry
XCV0858           CDS       T00288                                 

Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00620  Pyruvate metabolism
xcv00680  Methane metabolism
xcv01100  Metabolic pathways
xcv01120  Microbial metabolism in diverse environments
xcv01200  Carbon metabolism
Module
xcv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCV0858
  09102 Energy metabolism
   00680 Methane metabolism
    XCV0858
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XCV0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: CAJ22489
UniProt: Q3BXC4
LinkDB All DBs
Position
980035..982749
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLTGRQPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDAKTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSAELTAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
EGAYSAPSELEHDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDAQDATQRAAVLGPYAAGQEPLPRVDDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREAHWRPVMDLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKAWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggcgcactggtgggtgatctgctcgccgagcaggtgtctgcggaattt
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgcccca
ccttccacgctgagcgaacaactcaccggacggcagccgcgtgacgccgaagcgttggtc
cgggcgttcagcacctatttccaggtggtcaacatcgccgagcgcgtgcaccgcatccgc
cgccgccgcgaataccagcgcagcggcaccgatacgccgcagcccgatggcctgcatgac
gcattgcgccgcctcaaggcgcagggcgtgaccctggacgaactcagccaatggttgccg
cgcatcgatgtggagccggtgttcaccgcgcatcccaccgaggcggtgcggcgcgcgctg
ctggaaaaagaacagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaacgaacgcgccagcgacgccgcgcgcttccgcatggccctgaccgcgtcgtggcag
actgccgattcctcgccggtgcgccccaccgtggacgacgagcgcgagcacgtgggcttc
tacctcacccaggtgctctatcgcgtcatcccggtaatgtacgaaacgctggaacacgcc
atcgaagaaacctacggcagcgtgccggcattgccgcgtttgctgcgcttcggcacctgg
gtgggcggcgacatggacggcaatcccaatgtggatgccaagaccatcgccgggacgctg
gacgcgcagcggcgcgcggtgctggaccgctatcagaaagaactctggcagttggccagc
ctgctcagtcaatcgaccacgctggtgcaggtgagcgccgaactcaccgcacagctggag
cgctaccgcgcgctgctccccgacgcggccgcgcgttcgcgcccgcgccatggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcgcgcctgcaggccacactggacgatgcc
gagggcgcttacagcgcaccttcggagctcgagcacgacctgcaattgatcctggacagc
ctgcaggccaacaagggcctgcatgccgggtggttcgcggtgcggcgtctgctgtggcgc
gtgcgcagcttcggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcggtggccgatgccctgggccagaccgattgggatgcgcaggatgccacccag
cgcgctgccgtgctcggcccgtatgccgcagggcaggaacctttgccgcgcgtggacgat
gaaggcaatgcacggttggatgcggtattcgccgcgcttgccgatgcgcgcacccgccat
ggcgccgatgcattgggcagctacatcatctcgatggcgcataaccgcgccgacgtgttg
accgtgctggcactggcccggcgtggcggcttggtcgacgatgccggcgcggtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggcaccggcaccgtgcag
gacctgctggccgacccggtgtatcgccagcatctggccgcgcgcggcgatacgcagatg
gtgatgctgggctattcggacagcggcaaggacggtggcatcgccgcctcgcgctggggc
ctgcaacgcgcgcaggtcgagttgctggaagcggccgccgaattgggcgtgcggctgacc
ttcttccacggccgtggcggctcgatcgcgcgcggcggtggcaagaccagccgcgcgctg
gatgccgcaccgcgcggcagcgtggatggccgcctgcgcgtcaccgagcagggcgaggtg
atccaccgcaagtacggcatccgcgctctggcgttgcgctcgctggagcagatgaccggc
gcggtgctgctctcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcattggcgc
ccggtgatggatctggtggccgaacgcagcacggttgcgtatcgcgccttcgtcggcgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgagcgcatgacg
ctgggctcgcgtccgtcgcggcggctgggccaggacgcggccttgtccaacctgcgtgcg
attccctgggtgtttgcgtggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagacaccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgacatcgccatggtgttgtccaagggc
gacctgaatatcgccgagttgttctcgcgcttgtccggcgacctgcacacgcggtttttc
ccgctgattcgcgacgaacttgccttgaccaaggcctgggtgaaggcgctgctgcaacaa
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgtctgcgcaatccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgcgccaccgatggc
gaagacgaagcgctgctgcgtgcgctggtggcctgcgtcaacggcgtctcgcagggcgtg
cagaacaccggctga

DBGET integrated database retrieval system