KEGG   Xanthomonas campestris pv. vesicatoria: XCV0907
Entry
XCV0907           CDS       T00288                                 

Gene name
ubiH
Definition
(GenBank) 2-octaprenyl-6-methoxyphenol hydroxylase
  KO
K03185  2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00130  Ubiquinone and other terpenoid-quinone biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    XCV0907 (ubiH)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     XCV0907 (ubiH)
SSDB
Motif
Pfam: FAD_binding_3 Lycopene_cycl Pyr_redox Pyr_redox_2 FAD_binding_2 DAO FAD_oxidored Trp_halogenase NAD_binding_8 SE GIDA
Other DBs
NCBI-ProteinID: CAJ22538
UniProt: Q3BX75
LinkDB
Position
1036560..1037768
AA seq 402 aa
MTHPHDVLIVGGGLVGSSLAIALDRLGLDVGLVEATPAGTPPAVFDQRNLSFAAATVNAL
GALGVMAKLRSPPGPIRRIHVSRAGDFGRVQLDAADYGRDAFGQVVVARDFGDALQTRLD
ELTHLRRYRPARCIGIEPVQDDVRAVRLATDAGEQRVQARLVVGADGSHSAVRELLHIGT
DAHDFLQTLFVARVRASRPPDGTAWERFGEHGPTALLPRGDRHYGAIHCVARTEAEAVAA
LDDAGWLARLQRAAGWRAGRFVATGERSAYPLVQVLANSLIAERVVLLGNAAQTLHPIGA
QGFNLGLRDSLTLAELIEHDRSDAGAGALLAEYLARRRVDREHTIGFSSGLARLTGNPAP
LLRPLRSLGLFATSQAAPLQSMLVGGAMGFRGDVPQLCRSSA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgacacatccccatgacgttctgatcgttggcggcggcctggtcggctccagccttgcg
attgcgctggaccgcctcggcctggatgtcgggctggtggaggccaccccggccggcacg
ccgccggcagtgtttgatcaacgcaacctcagtttcgccgcggccacggtgaacgcgctg
ggtgcgctcggggtgatggccaagctgcgcagcccgcccgggccgatccggcgcatccat
gtcagccgcgccggggacttcggccgcgtgcaactggacgcggccgattacggccgcgac
gccttcggccaggtggtggtggcacgcgacttcggcgatgccttgcagacccgtctggac
gaactgacccatctgcggcgttaccggcctgcgcggtgcatcggcatagagccggtgcag
gacgacgtgcgcgcggtgcgcctggccaccgatgcgggcgagcaacgtgtgcaggccaga
ctggtggtcggcgccgatggcagccatagcgcggtgcgcgagctgctgcacatcggtacc
gatgcccacgatttcctgcagaccctgttcgtggcgcgcgtgcgtgcgtcacgaccgccc
gatggcacggcctgggagcgttttggcgaacatgggccaactgcgctgttgccacgcggc
gaccgccattacggtgcgatccactgcgtggcgcgcaccgaggccgaggccgtggctgcg
ctcgatgacgccggctggctggcgcgcctgcagcgtgccgccggctggcgtgccgggcgc
ttcgtcgccaccggcgagcgcagtgcctatccgctggtgcaggtgctggccaacagcctc
atcgccgagcgcgtggtgctgttgggcaatgccgcgcagacgctgcatccgatcggtgcg
cagggcttcaacctggggctgcgcgattcgctgacgctggccgaattgatcgagcacgat
cgcagcgatgccggtgccggtgcgttgctggccgagtatctggcgcggcggcgggtggac
cgcgagcacaccatcgggttttccagcggtctggcgcggctcaccggcaacccggcgccg
ttgctgcggccgttgcgtagcctgggcttgtttgccacgtcgcaggcggccccgctgcaa
tcgatgctggtaggcggcgccatgggctttcgtggcgatgtgccgcagctgtgccggagc
agcgcatga

DBGET integrated database retrieval system