KEGG   Xanthomonas campestris pv. vesicatoria: XCV1208
Entry
XCV1208           CDS       T00288                                 

Definition
(GenBank) putative thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XCV1208
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     XCV1208
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 cNMP_binding NAD_binding_8 Pyr_redox DAO FAD_binding_3 K_oxygenase Thi4 HI0933_like FAD_oxidored FAD_binding_2 Lycopene_cycl NAD_binding_9 GIDA MliC 3HCDH_N
Other DBs
NCBI-ProteinID: CAJ22839
UniProt: Q3BWC4
LinkDB
Position
1353343..1355052
AA seq 569 aa
MSLDQTRHHQMFPELDAGQLSITRRFASGPAQRFDAGDPVFEVGDAHAPVWVVLEGAIEV
VRRDGLGNEKPITRHTPGQFTGEVSQLAGRASLAAGRAGPDGCLALPFDTAHLRALMISS
AEVGEVVMRALILRRVGLIEGDASGSVLIGEPDDPHLTRLQGFLTRNGYPNTVMDVSDDE
GRALVERLGIQEHDLPVMVCPSGRVLRQPSDAEAAHCLGMTPDIDPDKRYDVAIVGAGPA
GLATAVYAASEGLSVLVLDQRAIGGQAGASARIENYLGFPTGISGQALAGRAYNQALKFG
AELAIPIEAATLECGRDDGALKLDLADGKQLLASTVVIASGARYRRPEIDGLDRFEGHGV
SYWASPVEARLCEGGVVALVGGGNSAGQAVAFLAPRVKELHLIIRGDGLESSMSQYLIER
IAALSNVQLHTGTEVAALDGDPERGLQAAVLRTRKDGATARVALRHLFLFVGADPNTGWL
QDCVDTDKRGFVMTGTARGDGVPACLPLETNRPGVFAIGDVRAGSVKRVAAAVGEGAAVV
AQIHQYLAHQANPVPVSELASATQESTSA
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgtctttggaccagacccgccaccatcagatgtttcccgagctggacgcgggccagttg
tcgatcacccggcgctttgccagcgggccggcgcaacggttcgacgcgggcgaccccgtg
ttcgaggtcggcgatgcccatgcgccggtgtgggtggtgctggagggcgccatcgaagtg
gtgcgccgcgacggactgggcaacgaaaagccgatcacccggcacacgcccggccagttc
accggcgaggtgagtcagctggccgggcgcgcgtcgctggcggctggacgtgccgggccg
gacggctgcctggcgctgccattcgataccgcgcatctgcgcgcgctgatgatcagttcg
gccgaagtgggcgaagtggtgatgcgtgccttgatcctgcgccgcgttgggctgatcgag
ggcgatgcgtcgggttcggtgctgatcggcgagcctgacgatccgcatctgacccgtttg
cagggctttttgacccgcaacggctaccccaacacggtgatggatgtctccgacgacgaa
ggccgcgcgttggtggagcgcctgggtatccaggagcacgacctaccggtgatggtgtgc
ccgagcgggcgcgtgctgcgccagcccagcgatgccgaagctgcgcattgcctgggcatg
acgccggacatcgacccggacaaacgctacgacgtggcgattgtcggcgccggccctgcc
ggcctggcgacggcggtgtatgccgcatccgaaggcttgtcggtgctggtactggaccaa
cgcgccatcggcgggcaggccggtgcctcggcgcgtatcgaaaattatcttggctttccc
accggcatttccgggcaggcgctggccgggcgcgcctacaaccaggcgctgaaattcggc
gcggaactggcgattccgatcgaagcggccacgctggaatgcggccgcgacgatggcgcg
ctgaagctggatcttgccgatggcaaacagctgctggccagcacggtggtaatcgcctcg
ggcgcgcgttaccggcgcccggagatcgatggcctggatcgcttcgaaggccacggtgtc
tcgtactgggcctcgccggtggaggcgcgcctgtgcgaaggcggcgtggtggcgctggtg
ggcggcggcaattctgcagggcaggcggtggcgttcctggcgccgcgggtcaaggaactg
cacctgatcattcgtggcgatgggctggagagctcgatgtcgcaatacctcatcgagcgc
atcgccgcgttgtcgaacgtgcagctgcacaccggcaccgaagtggccgcgctggacggc
gaccccgagcgcggcctgcaggccgcggtgttgcgcacccgcaaggacggtgcaaccgcg
cgcgtggcgttgcggcacctgttcctgttcgtcggggcagatcccaacaccggttggctg
caggactgcgtggacaccgacaagcgcggctttgtcatgaccggcaccgcgcgtggcgac
ggcgtaccagcgtgcctgccgctggaaaccaatcgccctggcgtgttcgccatcggtgac
gtgcgtgcgggttcggtcaagcgcgtggcggccgcagtgggcgagggcgccgccgtggtc
gcgcagatccatcagtacctcgcccatcaggccaacccggtgccggtctccgaacttgcc
agcgccacccaggagtcgaccagcgcatga

DBGET integrated database retrieval system