KEGG   Xanthomonas campestris pv. vesicatoria: XCV1576
Entry
XCV1576           CDS       T00288                                 

Gene name
lpd
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00010  Glycolysis / Gluconeogenesis
xcv00020  Citrate cycle (TCA cycle)
xcv00260  Glycine, serine and threonine metabolism
xcv00280  Valine, leucine and isoleucine degradation
xcv00310  Lysine degradation
xcv00380  Tryptophan metabolism
xcv00620  Pyruvate metabolism
xcv00630  Glyoxylate and dicarboxylate metabolism
xcv00640  Propanoate metabolism
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01120  Microbial metabolism in diverse environments
xcv01200  Carbon metabolism
Module
xcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xcv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCV1576 (lpd)
   00020 Citrate cycle (TCA cycle)
    XCV1576 (lpd)
   00620 Pyruvate metabolism
    XCV1576 (lpd)
   00630 Glyoxylate and dicarboxylate metabolism
    XCV1576 (lpd)
   00640 Propanoate metabolism
    XCV1576 (lpd)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCV1576 (lpd)
   00280 Valine, leucine and isoleucine degradation
    XCV1576 (lpd)
   00310 Lysine degradation
    XCV1576 (lpd)
   00380 Tryptophan metabolism
    XCV1576 (lpd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcv04147]
    XCV1576 (lpd)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     XCV1576 (lpd)
Exosome [BR:xcv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   XCV1576 (lpd)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox AlaDh_PNT_C GIDA FAD_binding_3 FAD_binding_2 HI0933_like 3HCDH_N FAD_oxidored DAO 2-Hacid_dh_C NAD_binding_8 Thi4 Lycopene_cycl UDPG_MGDP_dh_N Pyr_redox_3 Nairovirus_M
Other DBs
NCBI-ProteinID: CAJ23211
UniProt: Q3BVA6
LinkDB
Position
complement(1778138..1779580)
AA seq 480 aa
MSEQEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSK
ALLDSSRQFWNMGHLFGDHGISFNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPY
YGFGQLLPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPFAKFDGDTIVDNVGGLDFT
AVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLD
IKLGAKVSKTEITGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLAEGTGVK
VTDRGQIEVDGHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIP
WVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAMGEPAGFVKVIADAETDRV
LGMHLVGVGVSELVHEGVLTMEFNGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgaacaagaacaattcgacgtcgtcgtcatcggtgccggtccggccggttatcac
gccgccatccgtgcggcgcagctgggcatgaaggtcgcctgcatcgacgcggcattgggc
aaggacggcaagccggcgctgggcggcacctgcctgcgcgtgggctgcattccgtccaag
gcgctgctggattcctcgcgccagttctggaacatggggcacctgttcggcgaccacggc
atcagcttcaacgacgccaagatggacgtgcccaccatgatcggccgcaaggacaagatc
gtgaagcagttcaccggcggcatcgcgatgctgttcaaggccaacaagatcactccgtac
tacggcttcggccagttgctgccgggcaacatcgtcaaggtgacccagcacgaaggcggc
gagatcgaactcaagggcaccaacgtgatcctggcggccggttcggagtcgatcgaactg
ccgttcgccaagttcgacggcgacaccatcgtcgacaacgtcggcggcctggatttcacc
gccgttcccaagcgtctggcggtcatcggcgccggcgtgatcggtctggagctgggcagc
gtgtggaagcgcctgggcgccgaggtcaccatcctcgaggcgctgccggacttcctggcg
ctggccgatgccgaggttgccaagaccgcgctgaaggaattcaagaagcagggtctggac
atcaagctgggcgccaaggtcagcaagaccgagatcaccggcagtggcgatgccaagcag
gtggtgctcagctacaccgacgcggccggcgagcagaccctgaccgtggacaagttgctg
gtggccgtgggccgcaaggccgccaccaagaacctgctggccgaaggcacgggcgtcaag
gtcaccgaccgcggccagatcgaggtcgatgggcattgccacaccggcgtggatggcgtg
tgggcgatcggtgactgcgtgcgcggcccgatgctggcgcacaagggcttcgaggaaggc
atcgcggtggcggagctgattgccggcctgccgggtcacgtcaacttcgacaccattccg
tgggtcatctacaccgagccggaaatcgcctgggtcggcaagaccgagcagcagttgaag
gccgaaggcgtcgcctacaaggccggcagcttcccgttcgcagcgatcggccgcgcggtg
gccatgggcgagccagccggcttcgtcaaggtcatcgccgatgccgaaaccgaccgcgtg
ctgggcatgcacttggtgggcgtgggcgtgtccgagctggtgcacgaaggcgtgctgacc
atggagttcaacggttcggccgacgacctggcgcgcatctgccacgcgcatccgacgctg
tccgaagcgatccacgatgccgccatggcggtgagcaagcgcgcgattcataaggctaac
tga

DBGET integrated database retrieval system