KEGG   Xanthomonas campestris pv. vesicatoria: XCV2055
Entry
XCV2055           CDS       T00288                                 

Gene name
trxB1
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XCV2055 (trxB1)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     XCV2055 (trxB1)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored Thi4 FAD_binding_2 GIDA HI0933_like FMO-like NAD_binding_8 Trp_halogenase Shikimate_DH NAD_binding_7
Other DBs
NCBI-ProteinID: CAJ23732
UniProt: Q3BTX7
LinkDB
Position
complement(2338678..2339646)
AA seq 322 aa
MSAFSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPG
DPHGLMGPDLMSRMQAHAERFETEVIFDHIHTADLSQRPFRLIGDGAEYTCDALIIATGA
TAKYLGIPTEEAFKGRGVSACATCDGFFYKDQDVVVVGGGNTAVEEALYLSNIARKVYLV
HRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQA
ITSAGFGCMAALDAERYLDKSA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagcgccttttctgccagccccgccaagcactcccgcctgttgatcctgggctccggc
ccggccggctggaccgccgcggtctacgccgcccgcgccaatctcaagccggtggtcatc
accgggctgcagcaaggcggccaactgatgaccaccaccgaggtggacaactggccgggc
gacccccacggcctgatgggtccggacctgatgagccgcatgcaggcgcatgccgagcgc
ttcgagaccgaggtcatcttcgaccatatccacacggcagatctgtcgcagcgtccgttc
cggctgatcggcgacggggccgagtacacctgcgacgcgctcatcatcgccaccggcgct
accgccaagtacctgggcatccccaccgaagaagccttcaaggggcgtggcgtctccgcc
tgcgccacctgcgacggcttcttctacaaggaccaggacgtggtggtggtcggcggcggc
aacaccgcggtcgaagaggcgctgtacctgtccaacattgcccgcaaggtctacctggtg
catcgccgcgatacgctgcgcgcagagaaaatcatgcaggacaagctgttcgccaaagtg
gccgccggcaagatcgagaccgtctggcaccatgccatcgacgaggtactgggcaacgat
gccggggttaccggcgtccgagtgaagtccaccatcgacggcagcacccgcgacatcgat
gcgcatggtttcttcgtggcgatcggccatcacccgaacacgcagttgttcgatggccag
ttggcaatgaacaacggctacctggaaatccgctccggcctgaacggcgccgcgaccgag
acctcggtggccggcgtgttcgccgccggcgacgtggccgaccagcattaccgccaggcc
atcacctcggccggcttcggctgcatggccgcgctggatgccgagcgttatctcgacaag
agcgcctga

DBGET integrated database retrieval system