KEGG   Xanthomonas campestris pv. vesicatoria: XCV2179
Entry
XCV2179           CDS       T00288                                 

Definition
(GenBank) putative NAD(FAD)-dependent oxidoreductase
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00071  Fatty acid degradation
xcv00360  Phenylalanine metabolism
xcv01100  Metabolic pathways
xcv01120  Microbial metabolism in diverse environments
xcv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XCV2179
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    XCV2179
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     XCV2179
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox Pyr_redox_3 NAD_binding_8 DAO AlaDh_PNT_C HI0933_like GIDA Lycopene_cycl FAD_binding_2 Amino_oxidase FAD_binding_3 2-Hacid_dh_C Trp_halogenase 3HCDH_N UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: CAJ23856
UniProt: Q3BTK3
LinkDB
Position
complement(2506737..2507957)
AA seq 406 aa
MSGMVIVGAGQAGLQTAESLRSGGYTGSIVLLGDEPCAPYHRPSLSKGFLLGEVSDTQLY
IRAPGALNRKGIQWHASARVMRIEHATRTLHLDDGSTLGYTGLCLATGARARRLEVPGAG
LGHVCMLRGMADTRALAAILPHTSRVVVIGGGFIGLEFASIARRLGKQVVVLEAADRLMA
RVVSPQLADFFLRLHRDNGATIELGSNVSALSGNRGVVTAVHTADGRVFPADLVVVGIGV
IPNGELAQQAGLACDRGALIVDACARSSSPGIVGAGDCTVRQRAGSGLLRLESVQNAIEQ
AKSAAASLLGEHRPYPALPWFWSEQYEVRLQMAGFAAGHTQAVVRGDLATSTFSLFYYVD
GELCAVDSINRPQDHLAARKLLELGRSPTPQQAADPNFALTSLIPA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgagcggcatggtcatcgtcggtgcgggtcaggcgggcctgcagaccgccgaatccctg
cgcagcggcggctatacgggctccatcgtcttattgggggacgagccctgcgcgccctat
caccgtccatcgctctccaaggggttcctgcttggcgaggtgagcgacacccagctgtac
attcgcgcacccggggccttgaaccgcaagggcatccagtggcatgccagcgcgcgggtg
atgcgcatcgaacacgccacccgcacgctgcacctggacgacggcagcaccctgggctac
acggggctgtgtcttgccaccggcgcacgcgcccgccggctggaggtcccaggcgccggg
ctcggccatgtctgcatgttgcgcggcatggccgacactcgcgcgcttgccgcgatcctg
ccgcacacctcgcgggtggtggtgatcggtggcggcttcatcgggctggaattcgcctcc
atcgccaggcggctcggcaagcaggtcgttgtgctggaggcggccgatcggctgatggcg
cgcgtcgtcagcccgcaactggcggacttcttccttcgcctgcatcgagacaacggcgcg
accatcgaactgggcagcaacgtcagcgcattgagcggcaatcgcggcgtggtgactgcc
gtccacaccgcggacgggcgcgtgttcccggcagacctggtcgtcgtcgggatcggcgtc
atccccaacggcgaactggcccaacaggccggactggcttgcgatcgcggggcattgatc
gtggacgcgtgcgcacgcagtagcagccccggcatcgtcggtgccggcgactgcacggtg
cggcagcgggcaggcagcggtttgctgcggctggagtcggtccagaatgcaatcgaacaa
gccaaatccgctgccgcctcactgctgggcgagcaccgcccctaccctgcgttgccctgg
ttctggtcggagcagtacgaggtcaggctgcaaatggccggctttgccgcaggccacacg
caggcggtggtgcgcggcgacctggcgaccagcacgttctccctcttctactacgtcgat
ggcgaactctgcgccgtggactcgatcaatcggccacaggatcatctggcggcccgcaag
ctgctcgaactgggacgctcgccgacgccgcagcaagccgccgaccccaacttcgcgttg
accagcctcatccccgcctag

DBGET integrated database retrieval system