KEGG   Xanthomonas campestris pv. vesicatoria: XCV2311
Entry
XCV2311           CDS       T00288                                 

Gene name
trxB2
Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XCV2311 (trxB2)
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     XCV2311 (trxB2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored Thi4 NAD_binding_8 GIDA HI0933_like FAD_binding_2 FMO-like Trp_halogenase K_oxygenase Shikimate_DH
Other DBs
NCBI-ProteinID: CAJ23988
UniProt: Q3BT71
LinkDB
Position
complement(2644801..2645760)
AA seq 319 aa
MTMATHHQLIILGSGPAGWTAAVYAARANLKPLVLTGLQMGGQLMTTTEVDNWPGDAHGL
MGPDLMTRMQAHAERFETEVVFDHIHTADLSKRPFTLTGDSAQYTCDALIIATGATAKYL
GIPSEEAFKGRGVSACATCDGFFYKDQDVIVVGGGNTAVEEALYLSNIARKVYLVHRRDT
LRAEKIMQDKLFAKVAAGKVETVWHHEVDEVLGNDMGVTGVRVKSTLDGSTRDIDAHGFF
VAIGHSPNTELFKGQLAMNNGYLEIRSGLGGNATQTSVEGVFAAGDVADQHYRQAITSAG
FGCMAALDAERFLDSAVVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaccatggcaacacaccatcagctcatcattctcggctccgggccggccggctggacc
gccgcggtctacgccgcccgtgccaacctcaagccattggttctcaccggcctgcaaatg
ggcggccagctcatgaccaccaccgaggtggacaactggccgggcgatgcccatgggctg
atggggccggacctgatgacgcgcatgcaggcccatgccgagcgcttcgagaccgaggtg
gtattcgaccacatccacaccgccgatctgtccaagcgcccgttcaccctgaccggcgac
agcgcgcagtacacctgcgacgcgctgatcatcgccaccggcgccaccgccaagtacctg
ggcattccgtccgaggaggcgttcaagggccgcggcgtctcggcctgcgccacctgcgac
ggcttcttctacaaggaccaggacgtgatcgtggtcggcggcggcaacaccgcggtcgag
gaggccctgtacctgtccaacatcgcccgcaaggtctacctggtgcaccgccgcgacacc
ctgcgcgcggagaagatcatgcaggacaagctgttcgccaaggtcgccgccggcaaggtc
gagaccgtctggcaccacgaggtggacgaggtgctgggcaacgacatgggcgtgaccggg
gtgcgggtgaagtccaccctggacggcagcacccgcgacatcgacgcccacggcttcttc
gtcgctatcggccacagcccgaacaccgagctgttcaagggccagttggcgatgaacaac
ggctacctggaaatccgttccggcttgggcggcaacgccacccagacctcggtggaaggc
gtgttcgccgccggcgacgtggccgaccagcactaccgtcaggccattacctcggccggc
ttcggctgcatggcggcactggacgcggagcgattcctcgactcggccgttgtccgataa

DBGET integrated database retrieval system