KEGG   Xanthomonas campestris pv. vesicatoria: XCV2745
Entry
XCV2745           CDS       T00288                                 

Definition
(GenBank) putative oxidoreductase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00330  Arginine and proline metabolism
xcv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    XCV2745
Enzymes [BR:xcv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     XCV2745
SSDB
Motif
Pfam: Pyr_redox_2 NAD_binding_8 FAD_binding_3 FAD_oxidored FAD_binding_2 GIDA HI0933_like Thi4 Pyr_redox DAO AlaDh_PNT_C Lycopene_cycl SO_alpha_A3 NAD_binding_9 Pyr_redox_3 Amino_oxidase XdhC_C Staph_opine_DH UDPG_MGDP_dh_N 3HCDH_N
Other DBs
NCBI-ProteinID: CAJ24424
UniProt: Q3BRY7
LinkDB
Position
complement(3125495..3126808)
AA seq 437 aa
MAERVLHFDVLVIGAGPAGLAAAQAAASQGVRVGVVDMQPRTGGQVWRSDVQHGAPADAR
ALRQQVAGNASITVLTRTQILLAQPGWLLADGPDGTLQLHYAALVLATGARELLLPFPGW
TLPGVTGAGAAQALAKQGWPLASKRVLVAGSGPLLLASAATLQRHGAQVLGIHEQTSPAA
LRQFALQLWRWPGKAAQAVALRLQLRAVAYRAGSIVVAAHGDTQLREVELAGPGGRTRLA
CDQLAVGYGLVPNTELAQLLGCQLHACGAHQQVQVDALLRTSVNQIFAAGEVCGIGGRDC
ALIEGAMAGHMAADAPEAALRLQPRRHAARAFADLLQQHFALDPRIRTLAQADTLICRCE
DVPLAALDSFDDARDAKLASRCGMGACQGRICGAALAELGRCPPDLSTDAGRRPPLFPVR
LAALADSFTSDSQGKHP
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggctgagcgcgtgctgcatttcgatgtgttggtgatcggcgccggcccggccgggctg
gcggcggcgcaggcggcggccagccaaggcgtgcgcgtgggcgtggtcgacatgcagcca
cgtaccggcggtcaggtgtggcgcagcgatgtgcaacacggcgcgccggccgatgcgcgc
gcattgcggcagcaggtggcgggcaatgcatcgatcaccgtgctgacgcggacgcagatt
ctgctggcgcaaccgggctggctgctggccgatggccccgacggcacgctgcaactgcat
tacgccgccctggtgctggccaccggtgcgcgcgaattgctgttgccatttccaggctgg
accttgcccggcgtcaccggtgccggcgccgcgcaggcgctggccaagcagggctggccg
ctggcgagcaagcgcgtgctggtggccggcagtggcccgttgttgctggccagtgcggcc
acgttgcaacggcatggcgcgcaggtgctcggcattcacgaacagacctcgccggccgcc
ttgcgccagttcgcactgcagttgtggcgctggccgggcaaggccgcgcaggcggtggcc
ttgcgcctgcagctgcgtgcagtggcatatcgcgccggcagcatcgtggttgccgcgcat
ggcgacacgcagctgcgcgaagtggagctcgccgggcccggcggccgcacgcgtctggcc
tgcgatcaactggcggtgggctatgggctggtacccaacaccgagcttgcgcaattgctg
ggttgccagctgcatgcctgcggcgcgcaccagcaggtgcaggtggatgcgctgttgcgt
accagcgttaaccagatctttgccgccggcgaagtctgcggcatcggcgggcgcgattgc
gcattgatcgaaggagcgatggccggacacatggcggccgatgcaccggaggcggcgctg
cgtctgcagccacggcgtcacgccgcgcgtgcgtttgccgatctgctgcagcagcacttc
gcgcttgacccgcgcatccgcacgctggcacaggcggacaccttgatctgccgctgcgaa
gacgtgccgctggccgccctggacagcttcgacgatgcacgcgacgccaagctcgcctcg
cgctgcggcatgggcgcctgccagggccgtatctgcggcgcggcgctggccgaactgggg
cgctgcccgcccgatctttctaccgacgccggccgccggccgccgttgttcccggtccgc
ctcgcggcgctggccgactcgttcacttccgactcgcaagggaaacatccatga

DBGET integrated database retrieval system