KEGG   Xanthomonas citri pv. citri MN10: J162_02161Help
Entry
J162_02161        CDS       T03779                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00071  Fatty acid degradation
xcw00280  Valine, leucine and isoleucine degradation
xcw00281  Geraniol degradation
xcw00362  Benzoate degradation
xcw00592  alpha-Linolenic acid metabolism
xcw01100  Metabolic pathways
xcw01110  Biosynthesis of secondary metabolites
xcw01120  Microbial metabolism in diverse environments
xcw01130  Biosynthesis of antibiotics
xcw01212  Fatty acid metabolism
Module
xcw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J162_02161
   00592 alpha-Linolenic acid metabolism
    J162_02161
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J162_02161
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    J162_02161
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J162_02161
   00642 Ethylbenzene degradation
    J162_02161
Enzymes [BR:xcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     J162_02161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJZ04299
UniProt: A0A0U5BSM8
LinkDB All DBs
Position
complement(2343113..2344318)
Genome map
AA seq 401 aa AA seqDB search
MSKQIQEAYIVAATRTPVGKAPKGVFRNTRPDDMLAHVLRAVVAQAPGIDTSRIDDAIIG
CAMPEGEQGMNVARIGVLLAGLPNSVAGQTINRFCSSGIQAIAMAADQIRLGNADLMLAG
GTESMSMVPMMGNKVAMSPSVFADDHVAIAYGMGITAEKVAEEWKVSREDQDAFALASHQ
KAIAAIAAGEFRDEISPYEIHSHQPDLAGNVITLRKKLVDTDEGPRPDSSLEGLAKLRPV
FRNGQFGGSVTAGNSSQMSDGAGAVLLASEQAIRDYGLTPLARFVSFSVAGVRPEVMGIG
PIAAIPKALKQAGLTKDQLDWIELNEAFAAQALAVIRDSELDPSKVNPLGGAIALGHPLG
ATGAIRAATLVHGLRRRQQKYGMVTMCIGTGMGAAGIIEAL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacagattcaagaagcctacatcgtcgccgccacacgtacgccggtaggcaag
gcgccgaagggcgtgttccgcaacacccgccccgacgacatgctggcgcacgtgctgcgc
gccgtggtcgcgcaggcgccgggcatcgatacctcgcgcatcgacgacgccatcatcggc
tgcgcgatgcccgaaggcgagcaaggcatgaacgtggcgcgcattggcgtgctgctggcg
ggcctgcccaattcggtggccggtcagaccatcaaccgcttctgttcgtccggcatccag
gccatcgccatggcggccgatcagattcgtctgggcaatgccgacctgatgctggccggc
ggcactgagtcgatgtcgatggtgccgatgatgggcaacaaggtggcgatgtcgccaagc
gtgttcgccgacgaccatgtggccattgcgtacggcatgggcatcactgccgagaaggtc
gcagaagagtggaaggtgtcgcgcgaagaccaggatgcgttcgcgctggcctcgcaccag
aaagcgatcgcggcgattgcggccggcgagttccgcgacgaaatcagcccgtacgaaatc
cactcgcaccagcccgacttggccggcaacgtcatcaccttgcgcaagaagctggtcgat
acggacgaaggtccgcgtccggacagctcgctcgagggcctggccaagctgcgcccggtg
ttccgcaacggccagttcggcggcagcgtcaccgccggcaattcgtcgcagatgagcgat
ggtgccggcgcggtgctgctggcctccgagcaggcgatcagggattacggcctgactccg
ctggcccgcttcgtcagcttctcggtcgctggcgtgcgcccggaagtcatgggtatcgga
ccgatcgccgccattcccaaggcgctcaagcaggccggcctgaccaaggaccagctggac
tggatcgagctcaacgaagccttcgcggcacaggcgttggcggtcatccgcgacagcgag
ctggatccatccaaggtcaacccactgggcggcgcaatcgcccttggccacccgctgggc
gccaccggcgcgatccgtgcggccacgctggtgcatggcctgcgccgtcgtcagcagaag
tacggcatggtcaccatgtgcatcgggaccggcatgggcgctgcgggcatcatcgaagcg
ctgtaa

DBGET integrated database retrieval system