KEGG   Xanthomonas citri pv. citri MN10: J162_02162Help
Entry
J162_02162        CDS       T03779                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00071  Fatty acid degradation
xcw00362  Benzoate degradation
xcw00650  Butanoate metabolism
xcw01100  Metabolic pathways
xcw01120  Microbial metabolism in diverse environments
xcw01200  Carbon metabolism
xcw01212  Fatty acid metabolism
Module
xcw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    J162_02162
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J162_02162
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J162_02162
Enzymes [BR:xcw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     J162_02162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_binding_8 Shikimate_DH ApbA NfrA_C
Motif
Other DBs
NCBI-ProteinID: AJZ04300
UniProt: A0A0U5FF28
LinkDB All DBs
Position
complement(2344475..2346847)
Genome map
AA seq 790 aa AA seqDB search
MSNPLLVRRAAVLGAGVMGAQIAAHLTNAGVDTVLFDLPAKEGPADGIVLKAIANLGKLS
PAPLASKALAEAITPANYESGLEQLRDCDLIIEAIAERMDWKQDLYKKIAPFVSEHAVLA
SNTSGLGINKLSDVLPEQLRHRFCGVHFFNPPRYMHLAELIPAKGTDKAVLEGLEAFLVT
TLGKGVVYAKDTPNFIGNRIGVFSILSTIHHTQEFGLGFDEVDALTGPLVGRPKSATYRT
SDVVGLDTMAHVIKTMGDTLPDDPWHQYFKSPKWLEALIAKGALGQKVGAGIFRKVGKDI
VVLDLHEQDYRAADRSAAPEVVEILKIKNPAEKFAKLRESQHPQAQFLWASFRDLFHYSA
FHLADIAETARDVDLAIRWGYGWSLGPFETWQAAGWKQVAQWIAEDISNGKSMSSAPLPN
WVFDGRDGVHGAEGSYSPARDAKLPRSSLPVYKRQRFPDPLLGEQFSPGETVFENDGVRM
WHDGDDIAVVSFKTKMNTVSDHVLNGLQDVVGRAEKDFAGLVIWQQKEPFSAGADLAGAL
GLLQAGKVDAFEALVANFQATSQRIKYAQVPVISAVRGLALGGGCEFQMHSAKTVASLES
YIGLVEAGVGLLPAGGGLKEIAVRASIAAGPGGDVFAELKKTFETVAMAKVSNSAVNAKE
LGLLRATDKVVFNSYESLHIAKAEARALAEGGYRAPLPARHIQVAGDVGIATFKMLLVNM
LEGRFISEYDYEIASRIATVVCGGEVDRGALVDEEWLLKLERKHFVELAQQEKTQARIGH
MLKTGKPLRN
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacccgttgctagtccgtcgtgccgccgtgctcggtgccggcgtcatgggcgcg
cagatcgccgcccacctcaccaatgccggtgtcgacaccgtgttgttcgacctgcctgcc
aaggaaggcccggccgacggcatcgtactcaaggcgatcgccaatctcggcaagctgagc
ccagccccgctcgccagcaaggcgctggccgaggcgatcacgccagccaactacgagagc
ggtctggagcaactgcgcgactgcgatctgatcatcgaagcgatcgccgaacgcatggac
tggaagcaggacctgtacaagaagatcgccccgttcgtctctgagcatgcagtgctggca
tccaatacctccggcctgggcatcaacaagctgtcggatgtgctgcccgagcagctgcgc
catcgtttttgcggcgtgcacttcttcaacccgccgcgctacatgcacctggccgagttg
attccggccaagggcaccgacaaggccgtgctcgagggcctggaagccttcctggtcacc
acgctcggcaagggcgtggtgtatgccaaggacacgccgaacttcatcggcaaccgcatc
ggcgtgttctcgatcctgtccaccatccatcacacgcaggaattcggcctgggcttcgac
gaagtcgatgcgctgaccggcccgctggtcggccgtcccaagtcggccacctaccgcacc
tccgatgtggtcggcctggacaccatggcgcacgtcatcaagaccatgggcgacaccttg
ccggacgacccgtggcatcagtatttcaagtcgccgaagtggctggaggcgctgatcgcc
aagggcgcgctgggccagaaggtcggggccggcatcttccgcaaggtcggcaaggacatc
gtggtgctggacctgcacgagcaggactaccgcgccgccgatcgcagtgccgcgccggaa
gtggtcgagatcctaaagatcaagaatccggccgagaagttcgccaagctgcgcgagagc
cagcatccgcaggcgcagttcctgtgggcgagcttccgcgacctgttccactacagcgcc
ttccatctggccgatatcgccgagaccgcacgcgatgtggatctggcgattcgctggggc
tacggttggtcgctgggcccgttcgagacctggcaggcagccggctggaagcaggtggcg
cagtggatcgccgaagacatctccaacggcaagagcatgagcagcgcaccgttacctaac
tgggtgttcgacggtcgcgatggcgtgcatggcgccgaaggctcgtatagcccggcgcgc
gacgccaagctgccgcgctcgtcgctgccggtgtacaaacgccagcgcttccccgatccg
ttgcttggcgagcagttctcgccgggcgaaaccgtgttcgaaaacgacggcgtgcgcatg
tggcacgacggcgacgacatcgcggtggtcagcttcaagaccaagatgaacaccgtttcc
gaccacgtgctcaacggcttgcaggacgtcgttggccgcgccgagaaggacttcgctggc
ctggtgatctggcagcagaaggagcccttctccgccggcgccgatctggccggcgcgctc
ggcctgctgcaggctggcaaggtcgatgccttcgaagcattggtcgccaatttccaggcc
accagccagcgcatcaagtacgcgcaggtgccggtgatctcggccgtgcgcggcttggca
ctgggcggcggttgcgagttccagatgcacagcgccaagacggtggcctcgctggagagc
tacatcggcttggtcgaagctggcgtcggcctgctgccggccggcggcggcctgaaggaa
atcgcggtacgtgcatcgatcgccgcaggcccgggcggcgacgtgtttgccgagctcaaa
aagaccttcgaaaccgtggcaatggccaaggtctccaactcggcggtcaatgccaaggaa
ctgggcctgctgcgcgccaccgacaaagtggtgttcaacagctacgagagcctgcacatc
gccaaggccgaagcgcgcgcactggccgagggcggctaccgcgccccgctgccggcacgc
catatccaggttgccggcgacgtcggcatcgccaccttcaagatgctgctggtcaacatg
ctggaaggtcgcttcatcagcgaatacgactatgaaatcgccagccgcatcgccacggtg
gtgtgcggtggcgaagtcgatcgcggcgcgctggtcgatgaagaatggctgctcaagctg
gagcgcaagcacttcgtcgaactggcccagcaggaaaagacccaggcccggattgggcac
atgttgaagacgggcaagccgttgaggaactga

DBGET integrated database retrieval system