KEGG   Xanthomonas citri pv. citri MN10: J162_02226Help
Entry
J162_02226        CDS       T03779                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00020  Citrate cycle (TCA cycle)
xcw00190  Oxidative phosphorylation
xcw00650  Butanoate metabolism
xcw01100  Metabolic pathways
xcw01110  Biosynthesis of secondary metabolites
xcw01120  Microbial metabolism in diverse environments
xcw01130  Biosynthesis of antibiotics
xcw01200  Carbon metabolism
Module
xcw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xcw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J162_02226
   00650 Butanoate metabolism
    J162_02226
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    J162_02226
Enzymes [BR:xcw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     J162_02226
    1.3.5.4  fumarate reductase (quinol)
     J162_02226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-ProteinID: AJZ04359
UniProt: A0A0U5FGX1
LinkDB All DBs
Position
2413621..2415411
Genome map
AA seq 596 aa AA seqDB search
MSAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAAL
GNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQR
PFGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGV
CRGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDM
EFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVE
IREGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNM
GGIPTNFYGEVVRKRGDDADAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVAN
RCAETVKPNQPHKTLPSDACDKALGLLDKLRHANGSTPTAVIRDNMQRTMQSDAAVFRTS
KTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESR
GAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFDYRPVHMYTLSKDVDVVPPKPRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttacaagatcacagaacacaagtacgacatggtcgtggtgggcgccggtggc
gccggcctgcgcgccacgttcggcctggcccagaagggcctgcagacggtctgcctgacc
aaggtcttcccgacccgttcgcacaccgtggcagcgcagggcggtatttccgcagcgctg
ggcaacatgggcgaagacgattggcgttatcacttttacgacaccatcaagggttccgat
tggctgggcgaccaggacgcgatcgagtacatgtgtcgcgaggcgattccggccatcatc
gaactcgagcactacggcgtgccgttctcgcggaccgaagagggcaagatctaccagcgc
ccgttcggcggcatgaccaccaagtatggtgaaggcccgtccgcgcagcgtacctgcgcc
gcagccgatcgtaccggccacgccatgctgcataccttgtatcagcagtcgttggcgcac
aacgcacgcttcatgatcgagtacttcgcgctcgatctgatcttcgacgaagaaggcgtt
tgccgtggcgtgctcgcactggacatggccgaaggttcgctgcatctgttccgcgcccac
ggcgtggtgctggcgaccggcggttacggacgtgcctacttcagcgccacctccgcacac
acctgtaccggtgatggcggcggcctggtgatgcgtgcgggcctgcctgtgcaggacatg
gaattcgtgcagttccatcccactggcatctacggtgcgggctgcctgatcaccgaaggc
gtgcgcggcgaaggcggcatcctgcgtaacagcaatggcgagcgcttcatggagcgctac
gcaccgcattacaaggacttggcttcgcgcgacgtggtgtcgcgttcgatgacggtggaa
attcgcgaaggccgcggtgtaggcgagcacaaggatcacatcctgctcgacctgacccac
cttgggccggaagtgatcaacgaaaagttgcccggcatcgccgaaagcgcacacatcttc
gccggtgtggacgtgaccaagcagccgatcccggtgctgccgacggtgcactacaacatg
ggcggtattccgaccaacttctacggcgaggtcgtgcgcaagcggggcgacgatgcggat
gccgtggtgccgggcctgtatgccatcggcgaggcggcgtgcgtctcggtccatggtgca
aaccgtctgggctcgaactcattgctggacctggtggtgttcggtcgcgcggtcgccaac
cgctgtgccgaaacggtcaagcccaatcagccgcacaagaccttgccgtccgatgcctgc
gacaaggccctgggcctgctggacaagctgcgtcacgccaacggctccacgccgacggcc
gtgatccgcgacaacatgcagcgcaccatgcagtcggacgccgccgtgttccgcaccagc
aagacgctgaaagaaggcgtggacaagatggccgagatcttcgccaccttcgaggacgtc
aaggtgtcggaccgctcgctggtgtggaattcggacctgatcgagacctatgaattgaac
aacctgctgctcaacgcggtggcgacgatcaattcggccgaacagcgcaaggaaagccgt
ggcgcgcattcgcacgaagacttcccggaccgcgacgacgtcaactggcagaagcacacg
ttggtgaccgtcgacgacaagggcaagtgcgagttcgactaccgccctgtgcacatgtac
acgctgagcaaggatgtggacgtggtcccgccgaagccgcgcgtttactga

DBGET integrated database retrieval system