KEGG   Xanthomonas citri pv. citri MN10: J162_02228Help
Entry
J162_02228        CDS       T03779                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
xcw  Xanthomonas citri pv. citri MN10
Pathway
xcw00020  Citrate cycle (TCA cycle)
xcw00190  Oxidative phosphorylation
xcw00650  Butanoate metabolism
xcw01100  Metabolic pathways
xcw01110  Biosynthesis of secondary metabolites
xcw01120  Microbial metabolism in diverse environments
xcw01130  Biosynthesis of antibiotics
xcw01200  Carbon metabolism
Module
xcw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xcw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J162_02228
   00650 Butanoate metabolism
    J162_02228
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    J162_02228
Enzymes [BR:xcw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     J162_02228
    1.3.5.4  fumarate reductase (quinol)
     J162_02228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AJZ04361
UniProt: A0A0U5FDG3
LinkDB All DBs
Position
2415641..2416423
Genome map
AA seq 260 aa AA seqDB search
MAEFTLPKNSKIGKGKHYPAKGAKNTRTFKVYRWDPDVDANPRTDSYEIDLDKCGPMVLD
ALIKIKNEIDPTLAFRRSCREGICGSCAMNIDGTNTLACTKAIAACGKSEVPIYPLPHMS
VIKDLVPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPEDRRKLDGLYECILCACCSTS
CPSYWWNGERYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCPK
GLNPALAIAEIKKLMMARRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttcaccctccccaagaattcaaagatcggcaagggcaagcattaccctgca
aagggcgccaagaacacgcgcaccttcaaggtctaccgctgggatccggacgtcgacgcc
aacccgcgcaccgacagttacgagatcgatctggataaatgcggcccgatggtcctggac
gcgctgatcaagatcaagaacgagatcgacccgacgctggcgttccgtcgctcctgccgc
gagggcatctgcggctcgtgcgcgatgaacatcgacggcaccaatacgctggcctgcacc
aaggcgattgccgcgtgcggcaagtccgaggtgccgatctatccgctgccgcacatgagc
gtgatcaaggacctggtgccggacctgacgcacttctatgcgcagtacgcgtcgatcaag
ccgtggatccgcacccagacgccgccgccgccggatcgcgagcgcctgcagtcgccggaa
gaccgccgcaagctggatggcttgtacgagtgcatcctgtgcgcctgctgctcgaccagc
tgcccgagctactggtggaatggcgagcggtatcttggcccggccatcctgctgcaggcc
taccgctggattatcgattcgcgcgacgaagacaccggtgcgcgtctggacgatctggaa
gacccgttcaagctgtatcgctgccacaccatcatgaactgcgcacggacctgcccgaag
ggcttgaatccagcgctggcgatcgccgaaatcaagaagttgatgatggcgcgtcgcgcc
tga

DBGET integrated database retrieval system