KEGG   Xanthomonas cucurbitae: EBN15_03475Help
Entry
EBN15_03475       CDS       T06553                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xcz  Xanthomonas cucurbitae
Brite
KEGG Orthology (KO) [BR:xcz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EBN15_03475 (ahpF)
Enzymes [BR:xcz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EBN15_03475 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO Glutaredoxin NAD_binding_7 AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: QHG86190
LinkDB All DBs
Position
complement(832022..833614)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQIHASIDDSPGSRDMLDLLEDLVLLSDKISLEAHRDDDQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQQLDGDYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGALFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDATRIAAKQAFDVLVIGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLVPAGADG
LVEIKLANGALLKSKTVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDRLRADEVLQRKLRSLHNVHIITSAQTTEVLGDG
QKVTGLVYTDRLAGSIQRIALEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDERGQTNVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSVPVSAQNVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtaacgcgcccg
atccagatccacgcctcgatcgacgacagccccggctcgcgcgacatgctcgacctgctg
gaagacctggtgctgctgtcggacaagatcagcctggaagcgcaccgcgacgacgaccag
cgcaagccttccttcgcgctgaccacgccgggccaggacatttcgctgcgctttgccggc
ctgccgatgggccacgagttcacctcgctggtactggcgctgctgcaggtgggcggccac
ccgtccaaggccaccgccgagctgatcgaacaggtgcagcaactggatggcgactaccgg
ttcgaaacctatttttcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgccgtgctcaacccgcgcatccagcacgtcgccatcgatggcgcgctgttccag
gatgaagtggaaactcgccagatcatgtcggtgccgaccgtgtacttgaacggcgaactg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgataccaacgccgcc
aagcgcgatgccaccagaatcgccgccaagcaggccttcgacgtgctggtgattggcggt
ggcccggccggtgctgccgcagcggtgtatgccgcacgcaagggcatccgcaccggcgtg
gcggccgaacgcttcggtggccaggtgctggacaccatgtcgatcgagaacttcatctcg
gtgccggaaaccgaaggcccgaagatggccgccgcgctggaacagcatgtgcgccagtac
gaggtggacatcatgaacctgcagcgtgccgagcaactggtgccggccggtgccgatggc
ctggtcgagatcaagctggccaatggcgccttgctcaagagcaagacggtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgccgggcgaagaccagtacaggaacaagggc
gtggcctattgcccgcactgcgatggtccgttgttcaagggcaagcgcgtggcggtgatc
ggcggtggcaattcgggcgtggaagcggcgatcgacctggccggcatcgtggcgcatgtc
acgctggtggagttcgacgacaggctgcgcgccgacgaagtgctgcaacgcaagctgcgc
agcctgcacaacgtgcacatcatcaccagcgcgcagaccaccgaagtgttgggcgacggg
cagaaggtcaccggcctggtctacaccgaccggctcgctggcagtatccagcgcatcgcg
ttggagggcgtattcgtgcaaatcggcctgctgcccaacaccgagttcctgcgcggcacg
gtggccctgtcgccgcgtggggagatcatcgtcgatgagcgtggtcagaccaatgtaccg
ggcgtgttcgccgccggcgatgccaccaccgtgccgtacaagcaaatcgtgatcgccatg
ggcgaaggctccaaggccgccctgagtgcgttcgattacctgatccgctccagcgtgccg
gtcagcgcccaaaacgtcgcgcaagccgcgtaa

DBGET integrated database retrieval system