KEGG   Xenorhabdus doucetiae: XDD1_1924Help
Entry
XDD1_1924         CDS       T03784                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
xdo  Xenorhabdus doucetiae
Pathway
xdo00250  Alanine, aspartate and glutamate metabolism
xdo00410  beta-Alanine metabolism
xdo00640  Propanoate metabolism
xdo00650  Butanoate metabolism
xdo01100  Metabolic pathways
xdo01120  Microbial metabolism in diverse environments
Module
xdo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xdo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XDD1_1924 (puuE)
   00650 Butanoate metabolism
    XDD1_1924 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XDD1_1924 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XDD1_1924 (puuE)
Enzymes [BR:xdo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     XDD1_1924 (puuE)
Amino acid related enzymes [BR:xdo01007]
 Aminotransferase (transaminase)
  Class III
   XDD1_1924 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CDG17623
UniProt: A0A068QRL0
LinkDB All DBs
Position
1976772..1978058
Genome map
AA seq 428 aa AA seqDB search
MTESMLAKRRSAAIAKGVGVTTQVYVERAENAEIWDAQGQRYIDFAAGIAVVNTGHCHPR
VIAAAREQLEQFTHTCHQVVPYENYVALAERLNRLVPGHFVKKTVFVTTGAEAVENAVKI
ARAATGRSGVVAFSGAFHGRTFLGMSLTGKVAPYKMGFGPLVSDVYHVPFPVELHGISVE
QTLNALENLFRTDIEPTRVAAIIIEPVQGEGGFYPAPAELLESLRDIADRYGIVLIADEI
QTGFARTGKLFAMEHHQVAADLTTMAKGLAGGFPLAAVTGRAELMDAVVPGGLGGTYGGN
PVAIAASHAVLDVIEEEKLAARATQLGERLTQYLHELRPRVPQIADVRGFGLMIAVEFHR
AGSQEPDADFTNAVRQKALERGLILLTCGVHSNVIRFLPPLTIQDDVFDEALNILKSVLL
DLNGKEGK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctatgttagcgaaaaggcgcagtgcagctattgcaaaaggcgttggggtg
accactcaagtctatgttgagcgtgcggaaaatgcggaaatctgggatgctcaggggcaa
cgttatatcgattttgccgccggtatcgccgtggtgaataccggccactgtcatccgcgc
gtcattgccgcagccagggagcagttggaacagtttacccatacctgtcatcaagtcgtg
ccttatgaaaattatgtcgcgctggccgaacggctgaaccgtctggtgccgggccatttt
gtgaaaaaaaccgtctttgtcaccaccggggctgaggcagtcgaaaatgccgtcaaaatc
gcgcgtgcggctaccgggcgtagtggtgtggtggctttcagcggcgcttttcatggccgt
actttccttgggatgtcattaaccggcaaagtcgcgccgtacaaaatgggattcggcccg
ctggtcagcgatgtttatcatgtcccattcccggtagaactgcacggtatcagcgtggaa
cagacgttgaacgcgctggaaaatctctttagaaccgatattgaacccacgcgcgtcgcg
gccatcatcatcgaaccggtgcagggagaaggtggtttctatcctgcccctgccgagctt
cttgaatccctgcgcgacattgccgatcgttacggcattgtattgattgccgatgagatc
cagaccggtttcgcgcgcacgggcaaactgtttgccatggagcatcatcaggttgcggcc
gatctgaccacgatggcaaaaggtctggcgggaggatttccgctggcggcggtaacggga
cgcgcagaactgatggatgcggtggtgccggggggtctgggaggtacttatggcgggaat
ccggtggcgatagcggcgagtcatgcggtgctggatgtgatcgaagaagagaagctggcg
gcgcgtgcgacgcagttaggcgagcggctaacacaatatctgcatgaactgcggccgcgt
gttccgcagatcgccgatgtgcgtgggtttgggctgatgattgcggtggagtttcaccgt
gcgggcagtcaggaacccgatgctgactttaccaacgcggtgcgccagaaagcgctggag
cgtggcctgatcctgttgacgtgcggtgtgcatagtaacgtgatccgtttcctgccaccg
ctgacaatacaagatgatgtttttgacgaagcgctcaacattctgaaatcggtactgctt
gatctgaacggtaaagagggaaagtag

DBGET integrated database retrieval system