KEGG   Xenorhabdus doucetiae: XDD1_3896Help
Entry
XDD1_3896         CDS       T03784                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xdo  Xenorhabdus doucetiae
Pathway
xdo00564  Glycerophospholipid metabolism
xdo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XDD1_3896 (glpD)
Enzymes [BR:xdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XDD1_3896 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N Lycopene_cycl HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: CDG19581
UniProt: A0A068QY32
LinkDB All DBs
Position
4118118..4119611
Genome map
AA seq 497 aa AA seqDB search
METKDLIIIGGGINGAGIAADAAGRGLSVLLLEGQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDNLGKRVSLPGS
KGLKFGANSVLKPSITRGFEYSDCWVDDARLVVLNAQEVQKHGGEVRTRTQVTRAWRENG
HWMVEAKDLKTGETYTWRAKGLVNATGPWVKNFFDNGLQLKSPYGIRLIKGSHIVVPRVH
DEPQAYILQNEDNRIVFVIPWNDEFSIIGTTDVEYKGDPKEVKIDDKEIDYLLKVYNDHF
KKQLGRNDVVWTYSGVRPLCDDESDSPQAITRDYTLDVQDEQGQTPLLSVFGGKLTTYRK
LAEHAMDKLTQYYPNAGKAWTKNGKLPGGELEGCDRDGYARLLRQRHNWLPEGTALRYAR
TYGSNSQVILKNAEALTDLGECFGHGLYEAELRYLVEHEWVTQLDDAIWRRTKLGMWLTD
EQKQRVADWLTQNVKAA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgattatcatcggcggtggaattaacggcgccggtatcgcagca
gatgctgctggccgggggctttctgtcctattgttggaaggtcaagatttggccagcgca
acttcgtctgccagctccaagctgatccacggtggcttacgctatctggaacattatgaa
ttccgtttagtcagtgaagcactggcagaacgtgaagtgcttttgaaactggctccccat
attgcattcccgatgcgttttcgtttgccgcatcaacctcacctgcgcccagcctggatg
atccgcattggcctgttcctgtacgataatttaggtaaacgcgtcagcttaccgggcagt
aaggggctgaaatttggtgcaaactcagtattaaaaccctcaatcacccgtggttttgaa
tactccgactgctgggttgacgatgcgcgtctggttgttctgaacgctcaggaagtgcaa
aaacacggtggcgaagtgcgtacccgcactcaagttacccgcgcatggcgtgaaaatggt
cactggatggttgaagccaaagatcttaaaaccggcgaaacctatacctggcgtgcgaaa
ggtttggtcaacgcaactggcccgtgggtgaaaaatttctttgataacggcctgcaactg
aaatcgccttacggcatccgtttgatcaaaggcagccatattgttgtgccgcgagtgcac
gatgaaccgcaggcttatattctgcaaaatgaagataatcgcatcgtgtttgtgatcccg
tggaatgacgaattttccatcattggtacgacagacgttgagtacaaaggcgatccaaaa
gaagtcaaaattgacgataaagagatcgactatttgctgaaagtctataacgaccacttc
aagaaacaacttggccgcaatgatgttgtctggacttactctggtgttcgtcccctgtgt
gatgatgaatccgattcaccgcaagcgatcacccgtgactacacactggatgtgcaggat
gaacaaggtcagacaccattactgtccgtatttggcggtaagctgacgacttatcgtaaa
ttggctgaacacgccatggataaactgacccagtactaccccaatgcgggcaaggcatgg
actaaaaatggcaaattaccgggtggtgagctggaaggctgtgatcgcgatggttatgcg
cgtctgctgcgtcagcgtcacaactggttgccagaagggacggcactacgttacgcccgt
acttacggcagcaacagccaagtcatcctgaaaaacgcagaagcactgaccgatctcggc
gaatgcttcggccacggtttatatgaagctgaactgcgttatttagttgaacacgaatgg
gtgacgcagttagatgatgctatctggcgccgaaccaaactgggcatgtggctcaccgat
gaacagaaacagcgtgtagcggactggctgacacaaaacgtcaaagcggcttaa

DBGET integrated database retrieval system