KEGG   Xylella fastidiosa 9a5c: XF_0572Help
Entry
XF_0572           CDS       T00033                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa00061  Fatty acid biosynthesis
xfa01100  Metabolic pathways
xfa01212  Fatty acid metabolism
Module
xfa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    XF_0572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xfa01004]
    XF_0572
Enzymes [BR:xfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     XF_0572
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     XF_0572
Lipid biosynthesis proteins [BR:xfa01004]
 Fatty acid synthase
  Component type
   XF_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AAF83382
UniProt: Q9PFT5
LinkDB All DBs
Position
complement(556753..557274)
Genome map
AA seq 173 aa AA seqDB search
MMSRQHAYSREELLATARGELFSHSNARLPNDPMLMFDRITEIYADGGSHGKGIVNAELD
IRPDLWFFGCHFLGDPVMPGCLGLDAMWQLTGFFLTWSGATPGYGRALGCGEVKFTGQVL
PNAKLVRYEIEMTKIINRTLVIGQANARMLVDNREIYFAKDLRVGMFNSTESF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtcccggcaacatgcgtattcacgcgaagaactgctggcaaccgcgcgtggcgaa
ctcttcagtcacagcaacgcccgcctgccgaatgatccaatgctgatgtttgacagaatc
accgaaatttatgcagacggcggctcacacggtaagggtatcgtcaatgcggaacttgat
attcggccagatctgtggttcttcggttgccatttcctcggtgacccagtgatgccaggc
tgtctcggcctggacgccatgtggcaactcaccggtttttttctaacatggagcggcgca
acccccggatacggtcgtgcattgggctgcggcgaagtcaagttcacaggtcaagtactg
ccaaacgcaaaattggtgcgttacgaaatagagatgaccaaaatcatcaaccgcacactg
gtcattggtcaggccaatgcacggatgttggtagataatcgtgagatctatttcgccaaa
gacctgcgcgtgggtatgttcaacagcacagaatctttttag

DBGET integrated database retrieval system