KEGG   Xylella fastidiosa 9a5c: XF_1531Help
Entry
XF_1531           CDS       T00033                                 

Definition
(GenBank) subunit F of alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xfa  Xylella fastidiosa 9a5c
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XF_1531
Enzymes [BR:xfa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XF_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 DAO Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 AlaDh_PNT_C FMO-like K_oxygenase Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AAF84340
UniProt: Q9PD48
LinkDB All DBs
Position
1488446..1490161
Genome map
AA seq 571 aa AA seqDB search
MRRSFVCGDIFAVDSLYVSPSAICRAATPCAFNPPLQEIVMFDESLKAQLKAYLDRVIRS
IHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDDQRKPSFGLGTPGESISIRFA
GLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHYRFETYFSVSCQSCPDVVQAL
NMAAVLNPQIEHVAIDGALFQDEVEARQIMSVPTVYLNGELFGQGRMTLEQIVAKLDSGA
AKRTAESIQAKAAFDVLVVGAGPAGTAAAVYAARKGVRTGLVAERFGGQVLDTMTIENFI
SVPETDGPRMVAALEQHLRQYEVDIMNLQRVETLVPAGENGFIEVRLASGASLSSRTVIL
STGARWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIASY
VTLLEFDTKLRADEVLQRKLRSMSNVEVIMGAQTTEVRGDGKKVTGLVYVDRSTGGSFTL
ALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDECGHTSLPGVFAAGDATTVPYKQIVIA
MGEGSKAALSAFDYLIRNVVEITGIAQAQAA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcgcagttttgtatgtggggatatatttgctgttgattccctttatgtatccccg
tcggcgatttgccgtgcagcgacgccgtgtgcttttaatcctcctctccaggagatagtt
atgtttgatgaaagtttgaaggctcagcttaaagcctatttggatcgggtgattcgctcc
attcatattcatgcttctgtcgacgagagccacaagtcgcgtgagatgctcgatttactc
gaaaacattgtgctgctttcgggcaagaaggtcgttctggaggtgcatcgtgacgatgat
cagcgcaagccatcctttgggttgggtacgccaggagagagtatttcgatacgttttgct
ggtttgccgatggggcacgagtttgcttcattggtgcttgggttgttacaggttggtggg
catcctcctaaagtggctgatgatcttattgagcgggtacgtaacctggatggtcattat
cgttttgagacctatttttcagtttcttgtcagagttgcccggatgtggtgcaggcactg
aatatggctgcggtgttgaatccgcagattgagcatgtggctattgacggtgcattgttc
caggatgaggttgaggcgcgccagattatgtcagtaccaacggtgtatttgaatggcgag
ctgtttggtcaggggcgtatgacgttggaacagattgttgccaagcttgatagtggtgcg
gccaagcgcacagccgagagtatccaggctaaggctgcttttgacgtgttggtggttggt
gccggtccggctggtactgcagcggcggtatatgctgcgcgcaagggggtccggacgggt
ttggtcgctgagcgctttggtggccaagtgttggataccatgacgatcgagaacttcata
tctgttccggaaactgatggcccgaggatggttgcggcgctggagcagcatctgcgtcag
tatgaggtcgatatcatgaatttgcagcgtgtcgagacgttggtaccggctggagagaac
ggctttatcgaggtcagattggccagtggtgcgtcgctgagcagccgcaccgtgattctc
tctacgggtgcacgctggcgccagatgaatgtgcctggtgaggatgagtatcgcaacaag
ggggttgcttattgtccgcattgcgatggcccgttgttcaagggtaagcgtgtcgcggtg
attggcggtggtaattcgggagtcgaggcagcgatcgacttggctggaattgcttcatat
gtcacgttgcttgagttcgataccaagctgcgtgccgacgaagtattgcaacgcaagcta
cgcagtatgtcgaatgtggaagtcatcatgggtgcccagaccaccgaggtacgtggtgat
ggaaagaaggtgactggtttggtctatgttgatcgcagtactggtggaagctttacattg
gcgttggaaggcgtgtttgtgcagatcggtctgttacccaataccgagtggttgaaaggt
agggtggaattgtctccccgtggagaaattgtcgttgatgaatgtggtcataccagcttg
ccaggtgtgttcgctgctggtgatgcgaccacggtgccgtataagcagattgttattgcg
atgggggagggatctaaagccgcgttgagtgctttcgattatctgattcgtaatgtggtt
gaaattactggaattgctcaggcacaggcagcgtga

DBGET integrated database retrieval system