KEGG   Xylella fastidiosa 9a5c: XF_2325Help
Entry
XF_2325           CDS       T00033                                 

Definition
(GenBank) P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
xfa  Xylella fastidiosa 9a5c
Pathway
xfa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfa01100  Metabolic pathways
xfa01110  Biosynthesis of secondary metabolites
xfa01130  Biosynthesis of antibiotics
xfa01230  Biosynthesis of amino acids
Module
xfa_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
xfa_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:xfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XF_2325
Enzymes [BR:xfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     XF_2325
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     XF_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: AAF85124
UniProt: Q9PB20
LinkDB All DBs
Position
complement(2204374..2205498)
Genome map
AA seq 374 aa AA seqDB search
MTKPVNTTADKVALSDTALADIRTKIDKIDRDIQTLIAERACYAQQVGQAKSKLAAAMDY
YRPEREAQVLRMVVERNEGPLSDEVLVRLFREIMSACLAQQEPLKIGYLGPEGTFSQQAV
LKHFGHYVLGEPMASIEEVFQEVEAGHTDFGVVPVENSGHGTIQVTLDLFLNSKLKICGE
IELRVHQYLMSRSGRLEDIHRIYAHPQSFAQTACWLRANLPHVEKIPVSSNAEGARRASN
ANDAASIGSESAARVYALSKVFIHSIEDEQDNTTRFLVIGRRIFAPSGCDRTSILVFIRD
NPGALFEVLGSFARHGINMNRIESRPSHQVRWEYVFFIDLLGHVEDEPMKQALAELEQHA
VKVKILGAYPIALL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgactaagccggttaatactactgctgacaaggttgctctgtctgacacggcattggcc
gatatccgcactaaaatcgataagattgaccgtgatattcagacattgattgccgaacgt
gcgtgttatgcccagcaagtcggtcaggcaaaaagcaaacttgccgctgcgatggattac
taccgccccgagcgtgaagcgcaggtgctacgtatggtggtggaacgcaatgaaggtccg
ttgtcagatgaagtgctagtccgcttgttccgtgaaattatgtctgcctgcttagcccag
caggaaccattgaagattggttaccttggtccggaaggcacctttagccaacaagcagtg
ctcaaacactttggccattatgtgcttggcgagcctatggccagtattgaggaggtgttc
caggaggtcgaggccggtcataccgatttcggagtagtgccggtggagaattcaggtcat
ggaacaatccaggttacgctggatttgtttttgaattctaaattgaaaatctgtggcgag
attgagttgcgcgtgcatcaatatctgatgtcgcgtagtggtcgccttgaagacattcat
cggatctatgcgcacccgcagtcgtttgcgcagaccgcctgttggctacgtgccaatctg
cctcatgttgagaaaatccctgtgtccagcaacgccgaaggtgcacgtcgtgcctccaat
gctaacgatgcagcttcgatcggtagcgagagcgccgcgcgagtgtatgcgttgagcaag
gtgttcatacactcgattgaagacgagcaggacaatacaacgcgttttctggtgatcggt
cgtcggatatttgcgccttccggatgcgatcgtacttcgattctggtgtttattcgtgac
aaccctggcgcattgtttgaagtgcttggttcatttgcgcgtcacggtatcaacatgaat
cgtattgaatcgcgtccttcccatcaggtcagatgggagtatgtcttttttattgatttg
cttggccatgttgaggatgaaccgatgaaacaggcactggctgaattggagcaacatgcg
gtgaaggtcaagatcctcggagcctatccaattgcccttctatga

DBGET integrated database retrieval system