KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_03820Help
Entry
XFLM_03820        CDS       T01979                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00550  Peptidoglycan biosynthesis
xff01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xff00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XFLM_03820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XFLM_03820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xff01011]
    XFLM_03820
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xff03036]
    XFLM_03820
Enzymes [BR:xff01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XFLM_03820
Peptidoglycan biosynthesis and degradation proteins [BR:xff01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   XFLM_03820
Chromosome and associated proteins [BR:xff03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    XFLM_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADN62736
LinkDB All DBs
Position
complement(799803..801644)
Genome map
AA seq 613 aa AA seqDB search
MKNRNNRFRSHFNLRGRLLLVGTALGLCSMTLIASAAYVQLINSDFYQRQAQARYLRELP
IPTSRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVLDVPMEELRTRLLQK
ADKEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEG
LELSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRN
AIIENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMK
PLTVATALQAGVVTPDTVIDTNPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKI
VAKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQ
IAQAYATLGNGGKLVPPTFVKGHHAEARQVVDAKVAQQVIGMMETVVTRGGAKAAAILGY
HVAGKTGTARKTGANGYESGHYNALFAGLVPATRPRFATVIVINDPQGKAYYGGLVSAPV
FHRVMEGALRLMDVPPDDIQSWLAAQAAGKTGRTPPRQVDPDPALVPDAADEVAAGIPTT
VTPSPSAIHRDRQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccgtaataaccgcttccgcagtcatttcaatttgcgtggtcggttgttgctg
gtcggtacagcgctgggcctgtgttcaatgacgttgatcgccagtgctgcctacgtgcag
ttgattaatagtgatttctatcagcgtcaggcccaagcgcgctacttgcgtgagctaccg
attccgacctcgcgtggaatgattacagatcgcaatggtgagccgttggcggtttctacg
ccggtcgagtcgatttggggaaatccacaggaactattgcggaatcctgatgccatctcg
aagttggccaaggtacttgatgtcccgatggaagaactgcgtactcgtttgttgcagaag
gccgataaagagttcatgtatttgaagcgccggatcaatcctgacgttgcacatcacgtt
cttgggttgcaaattcctggggtattcgcgcagcgtgaattcaggcgtttctaccctcag
agtgaggcaatggcgcatgtattgggttttaccaatattgatgaccgtggccaggaaggt
ctggagctgtcatttgatgattggttgacaggtaagcctggtagcaagcgtgtggtacgt
gatgcgcgtggcgcgattgtggagagtgtggatgcgatccggtcggcacagccgggtaag
gatttggtgttgacgattgatcgtcgtattcaatttcttgcttataaggaactgcgcaac
gccattattgaaaatcaagcggctggcggttcgattgtcgtcatggatgtgaacaatggc
gagattttagccatggtcaatttgccgacctacaaccctaacgcggtgaacgggattaat
tcttcagcacggcgtaatcgtgcggtgacggatctggttgagccaggttcgacgatgaag
ccgttgacggttgcgaccgcgctgcaagcgggtgtggtgacccctgatacggtcattgat
accaatcctggttatctgtcactgggacgttttaccatccgcgatgtgccgcgtaataac
ggtgtgctcaatgtgactggtgtgattacgcgcagttccaatattggtgctgccaagatc
gtcgccaaggtgccggacaaaacgttctacgaattggtgcaaggttttggttacgggaca
gcgcctcatagcggttttcctggtgaatccagcggtgtgttgcctttaccggcacgttgg
agcggtacttccaagaccactatgtcttacggttacggtctgtctgtgacgccgttgcaa
attgcgcaggcgtacgcgacgttgggcaatggcggcaagctagtcccgccgacgtttgtg
aaaggccatcatgccgaggcacgtcaagtcgttgatgccaaggttgcacagcaagtgatt
gggatgatggaaacggtggtcacacgtggaggggctaaggccgcggcgatccttggctac
catgttgctggaaagacgggcacggcgcgcaaaacgggcgctaatggctacgaatccggt
cattacaatgcgctgtttgctggtttggtacctgccacgcgcccgcgtttcgccacggtc
attgtgatcaacgatccgcagggtaaggcgtattacggtggcttggtatctgcacccgtg
ttccatcgggtgatggagggggcgctacggttgatggatgtgcctcctgacgacattcaa
tcatggttggctgcgcaggctgcaggaaaaactgggcggacgccaccgcggcaggtcgat
cccgatccggcattagtacccgatgctgccgatgaggtcgccgctggtattcctacgacg
gtgacaccatcgccgtctgcgattcatagagatcgccaatga

DBGET integrated database retrieval system