KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_05600Help
Entry
XFLM_05600        CDS       T01979                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff00790  Folate biosynthesis
xff01100  Metabolic pathways
Module
xff_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xff00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFLM_05600
Enzymes [BR:xff01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XFLM_05600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADN63059
LinkDB All DBs
Position
complement(1209432..1210328)
Genome map
AA seq 298 aa AA seqDB search
MFDTIPTLHCAGRTLRLDSPLVMGILNVTPDSFSDGGLYDSVDAAVAHGLRLIAEGADII
DIGGESTRPGAAPVPLEEELLRVVPVIKALAAYDKAVISVDTFKPEVMRAAVAAGAGLIN
DIYALRTPGALKAAAELAVPVILMHMKGEPHSTQTPQYDHVVDEVYRFLAERIFAAEIAG
IERHRLLIDPGFSFSKTTEHNIALLAALERFTNLGIPLLAGLSRKRSLGELTGRQLPIER
VYASVAAHLIAVQRGALIVRVHDVAAMVDALKVWQAVSAAAAPATHTKTTVARSPHDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacactatccccaccctgcactgcgccggacgcaccttgcgtctagacagtcca
ttggtcatgggtatcctcaacgtgactcctgattccttttccgacggaggcctgtatgac
tctgtggatgcagcagtggcgcatggattacgcctgattgctgagggtgcagacatcatt
gatattggcggggaatccacccgtcccggcgcagcgccggtaccgctggaggaggaacta
ctccgagtggtgccggtcatcaaggcattagctgcctacgataaagctgtcatcagcgta
gacaccttcaaacctgaggtaatgcgtgcggcagtcgctgccggtgccggcttgatcaat
gacatctatgcactacgcactcccggagcgctgaaagcagcagcagaactggctgtacca
gtgatattgatgcatatgaaaggtgagccgcactcaacgcaaacaccacagtacgatcat
gtggttgatgaagtgtaccgtttcctggccgagcggatttttgccgccgagatagcaggt
atcgaacgacaccgactgctgatcgatcctggtttcagtttcagcaagaccacggaacat
aacattgcactgttagcggcactggaacgtttcaccaatctcggcatcccattgttggcc
ggattgtcacgcaagcgtagcttgggcgaactgacaggacgtcagttaccaatcgaacgc
gtgtacgcctccgtcgctgcacatctcattgcggtacaacgcggcgcgttaatcgtacgg
gtgcatgatgtggcagctatggtcgatgccctcaaagtttggcaggcagtttcagcagcg
gctgcacctgcaacacataccaaaactacagtggctcgttcgccccatgacgactga

DBGET integrated database retrieval system