KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_09325Help
Entry
XFLM_09325        CDS       T01979                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Brite
KEGG Orthology (KO) [BR:xff00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XFLM_09325
Enzymes [BR:xff01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XFLM_09325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 Thi4 DAO Glutaredoxin FAD_binding_3 K_oxygenase FMO-like AlaDh_PNT_C NAD_binding_8 Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADN63755
LinkDB All DBs
Position
2039825..2041420
Genome map
AA seq 531 aa AA seqDB search
MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDD
KRKPSFGLSTPGESISIRFAGLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHY
RFETYFSVSCQSCPDVVQALNMAAVLNPQIEHVAIDGALFQDEVEARQIMSVPTVYLNGE
LFGQGRMTLEQIVAKLDSGAAKRTAESIQAKAVFDVLVVGAGPAGVAAAVYAARKGVRTG
LVAERFGGQVLDTMTIENFISVPETDGPRMAAALEQHVRQYEVDIMNLQRVETLVPAGEN
GFIEVRLASGASLSSRTVILSTGARWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKLRSMSNVEVIMGAQTTEVRGD
GKKVTGLVYVDRSTGGSFILALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDERGHTSL
PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaaagtttgaaggctcagctgaaagcctatttggatcgggtgattcgctcc
attcatattcatgcttctgtcgacgagagtcacaagtcgcgtgagatgctcgatttactc
gaaaatattgtgctgctttcgggcaagaaggtcgttctggaggtgcatcgtgacgatgat
aagcgaaagccatcctttgggttgagtactccaggagagagtatttcgatacgttttgct
ggtttgccgatggggcacgagtttgcttcattggtgcttgggttgttacaggttggtggg
catcctcctaaagtggctgatgatcttattgagcgggtacgtaacctggatggtcattat
cgttttgagacctatttttcagtttcttgtcagagttgcccggatgtggtgcaggcactg
aatatggctgcggtgttgaatccgcagattgagcatgtggctattgacggtgcattgttc
caggatgaggttgaggcgcgccagattatgtcagtaccaacggtgtatttgaatggcgag
ctgtttggtcaggggcgtatgacgttggaacagattgttgccaagcttgatagtggtgcg
gccaagcgcacagccgagagtatccaggctaaggctgtttttgacgtgttggtggttggt
gccggtccggctggtgttgcagcggcggtatatgctgcgcgcaagggggtccggacgggt
ttggtcgctgagcgctttggtggccaagtgttggataccatgacgatcgagaacttcata
tctgttccggaaactgatggcccgaggatggctgcggcgctggagcagcatgtgcgtcag
tatgaggtcgatatcatgaatttgcagcgtgtcgagacgttggtaccggctggagagaac
ggctttatcgaggtcagattggccagtggtgcgtcgctgagcagccgcacagtgattctc
tctacgggtgcacgttggcgtcagatgaatgtgcctggtgaggatgagtatcgaaacaag
ggggttgcttattgtccgcattgtgatggcccgttgttcaagggtaagcgtgtcgcggtg
attggcggtggtaattcgggagtcgaggcagcgatcgatttggctggaattgcttcatat
gtcacgttgcttgagttcgataccaaactgcgtgccgacgaagtattgcaacgcaagcta
cgcagtatgtcgaatgtggaagtcatcatgggtgcccagaccaccgaggtacgtggtgat
ggaaagaaggtgactggtttggtctatgttgatcgcagtactggtggaagctttatattg
gcgttggaaggagtgtttgtgcagattggtctgttacccaataccgagtggttgaaaggt
agggtggaattgtctccccgtggagaaattgtcgttgatgaacgtggtcataccagctta
ccaggtgtgttcgctgctggtgatgcgaccacggtgccgtataagcagattgttattgcg
atgggggaggggtctaaagccgcgttgagtgctttcgattatctgattcgtaatgtggtt
gaaattactggaattgctcaggcacaggcagcgtga

DBGET integrated database retrieval system