KEGG   Xylella fastidiosa Hib4: XFHB_00550
Entry
XFHB_00550        CDS       T04925                                 

Definition
(GenBank) cytosol aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00480  Glutathione metabolism
xfh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XFHB_00550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xfh01002]
    XFHB_00550
Enzymes [BR:xfh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     XFHB_00550
Peptidases and inhibitors [BR:xfh01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   XFHB_00550
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-ProteinID: ALR05594
UniProt: A0A1L2AY58
LinkDB
Position
complement(134673..136148)
AA seq 491 aa
MALQFQLNQTTPQTVTTDCVIVGIYADKTLSPTAKTLDAASGGRITALTARGDLTGKSGT
SALLHDLNGVTAPRVLVVGLGEADKFGPGQYIKAVGDAVRALKDAPVTHALLTLSELPVK
DRNAAWNIHQAVIAADHAAYRYTATLGTSRKKAAESGLITLAIHGQETSGLTLGQAIAEG
VEYARALGNLPPNICTPAYLAETTAHFAATHPGATCEILDESNMEALGMGALLAVARGSA
NRPRLIVLKWNGGGDARPYVLVGKGITFDTGGVNLKTQGGIEEMKYDMCGGAAVIGTFVA
AVKVRLPLNLIVIVPAVENAIDGNAYRPSDVITSMSGKTIEVGNTDAEGRLILCDALTYA
ERFKPEALIDVATLTGACMIALGRAATGLMTHHDDLANELLTAGEHVRDRAWRLPLWDEY
QGLLDSTFADVYNIGGRWGGAITAGCFLSRFTEGQRWAHLDIAGSASNEGKRGMATGRPV
GLLTQWLVDRC
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggccctccaattccagctcaaccaaaccacaccacagactgtcaccaccgattgcgtg
atcgtcggcatctatgctgacaagacactctcacccaccgcaaaaactctggacgccgcc
agcggcggccgcatcaccgcattgacagcacgcggcgacctcaccggcaaatctggcacc
tccgcgttactccacgacctgaacggtgtcaccgcaccccgtgtcctggtggtgggctta
ggtgaagcggataaattcggccccggacagtacatcaaagccgttggcgacgccgtccgc
gccctgaaagatgccccagtgacgcacgccctactcaccttatctgaactccccgtcaaa
gatcgcaacgccgcctggaacatccaccaagccgtgatcgccgctgaccacgccgcctac
cgctacaccgccaccctagggaccagccgcaaaaaagccgcagaatccggcctcatcacc
ctggcgatccacggtcaagagaccagcggactgacactaggtcaagccatcgctgaaggc
gtggagtacgcacgtgccctaggcaacttgccgccgaacatctgcacccctgcctatctg
gcagaaaccacagcccactttgccgccacacaccctggtgcaacctgcgaaatcctggac
gaatccaacatggaggccttgggcatgggcgcactgcttgccgtggcccgtggctcagcc
aaccgcccccgcctgattgtgctgaagtggaacggcggcggtgacgcccgcccctatgtc
ctcgtcggtaaaggcatcaccttcgataccggcggcgtcaacttgaaaacccagggcggc
attgaagagatgaagtacgacatgtgcggcggcgcggcggtcattggcaccttcgtcgcc
gccgtcaaagtacggctaccgctcaacctgattgtgatcgtaccggcggtagaaaacgcc
attgatggcaacgcctaccgcccctcggacgtgattaccagcatgtccggcaaaaccatc
gaagtcggcaacaccgacgcagaaggccgcctcatcctctgtgatgctctgacctacgcc
gaacgcttcaaaccggaagcactgatcgacgtcgccaccctcaccggcgcctgcatgatc
gccctcgggcgcgccgccaccggcctgatgactcatcatgacgatcttgccaacgaactg
ctgaccgccggtgagcacgtccgcgaccgcgcctggcgtctgcctctgtgggacgaatac
caaggcttgctggactccacgtttgccgacgtctacaacatcggcggccgctggggaggc
gccatcaccgccggctgcttcttatcgcgctttaccgaaggccaacgctgggcgcacctg
gatattgccggctcagccagcaacgaaggcaaacgcggcatggccaccgggcgtcctgtc
ggcctcctgacacagtggctcgtggaccgatgctaa

DBGET integrated database retrieval system