KEGG   Xylella fastidiosa Hib4: XFHB_04120
Entry
XFHB_04120        CDS       T04925                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XFHB_04120
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     XFHB_04120
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored GIDA Thi4 FAD_binding_2 HI0933_like NAD_binding_8 FMO-like Trp_halogenase
Other DBs
NCBI-ProteinID: ALR06165
UniProt: A0A1L2AUV5
LinkDB
Position
complement(913774..914739)
AA seq 321 aa
MSDYPASAKHSRLLILGSGPAGWTAAVYAARANLQPVLITGLQQGGQLMTTTEVDNWPGD
AHGLMGPDLMERMQAHAERFDTKVIFDQIYKADLSTRPFTLFGDSGLYTCDGLIIATGAN
AKYLGIPSEEAFKGRGVSACATCDGFFYRDQDVAVIGGGNTAVEEALYLSNIARKVYLIH
RRDKLRAEKIMQNKLFSKAATGKIELIWNNAVEEVLGNDASVTGVRIRSTQDSSTRDIDV
QGLFVAIGHHPNTDLFAGQLAMNNGYLQIHSGTAGNVTQTSVEGVFAAGDVADQHYRQAI
TSAGFGCMAALDAERFLDKGN
NT seq 966 nt   +upstreamnt  +downstreamnt
atgagcgattatcctgcctctgccaaacactcacgcttgttgatcctaggctctggccca
gctggatggactgccgctgtctacgccgcacgtgcaaaccttcaaccagtattaatcact
ggcctgcaacagggcggacaattgatgaccaccaccgaagtcgataactggcctggtgac
gcgcatggcctgatgggaccggacctaatggaacggatgcaagcccatgccgagcgcttc
gacacgaaagtcattttcgaccaaatttataaagccgatctttccacacgtccattcacc
ctttttggagacagcggcctctatacctgcgatgggttgatcatcgccacaggtgcgaac
gccaaatacttaggcatcccttccgaggaggcattcaaaggtcgaggggtatcagcctgt
gcgacgtgtgacggttttttctaccgcgaccaagatgtagccgtgataggtggcggtaac
acagccgtcgaggaggccttatatctgtccaacatcgcccgtaaggtttacttaatccat
cgccgtgacaaactgcgggccgaaaaaatcatgcaaaacaaactgttctcgaaagctgca
actggcaaaatagaattgatctggaacaacgcagtcgaggaggtgctcggtaacgatgct
agcgtcactggtgtgcggatccgatccacgcaagacagcagcacgcgtgacattgatgtc
caaggcctcttcgtggcaatcgggcatcatcccaacaccgatcttttcgcaggccaactt
gcaatgaacaacggctacctgcaaatccattcaggcaccgcaggcaacgtcacccaaact
tccgtagagggagtattcgcagcaggtgacgttgcggatcaacactaccgccaagcaatc
acctcagctggatttggctgcatggccgctctggacgcggaacggttccttgataaaggt
aactga

DBGET integrated database retrieval system