KEGG   Xylella fastidiosa Hib4: XFHB_04495Help
Entry
XFHB_04495        CDS       T04925                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xfh  Xylella fastidiosa Hib4
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XFHB_04495
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XFHB_04495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 DAO Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ALR06227
UniProt: A0A1L2AZW5
LinkDB All DBs
Position
1008896..1010491
Genome map
AA seq 531 aa AA seqDB search
MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDD
QRKPSFGLGTPGESISIRFAGLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHY
RFETYFSVSCQSCPDVVQALNMAAVLNPQIEHVAIDGALFQDEVEARQIMSVPTVYLNGE
LFGQGRMTLEQIVAKLDSGAAKRTAESIQAKAAFDVLVVGAGPAGTAAAVYAARKGVRTG
LVAERFGGQVLDTMTIENFISVPETDGPRMVAALEQHVRQYEVDIMNLQRVETLVPAGEN
GFIEVRLASGASLSSRTVILSTGAHWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKLRSMSNVEVIMGAQTTEVRGD
GKKVTGLVYVDRSTGGSFTLALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDECGHTSL
PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaaagtttgaaggctcagcttaaagcctatttggatcgggtgattcgctcc
attcatattcatgcttctgtcgacgagagccacaagtcgcgtgagatgcttgatttactc
gaaaacattgtgctgctttcgggcaagaaggtcgttctggaggtgcatcgtgacgatgat
cagcgcaagccatcctttgggttgggtacgccaggagagagtatttcgatacgttttgct
ggtttgccgatggggcacgagtttgcttcattggtgcttgggttgttacaggttggtggg
catcctcctaaagtggctgatgatcttattgagcgggtacgtaacctggatggtcattat
cgttttgagacctatttttcagtttcttgtcagagttgcccggatgtggtgcaggcactg
aatatggctgcggtgttgaatccgcagattgagcatgtggctattgacggtgcattgttc
caggatgaggttgaggcgcgccagattatgtcagtaccaacggtgtatttgaatggcgag
ctgtttggtcaggggcgtatgacgttggaacagattgttgccaagcttgatagtggtgcg
gccaagcgcacagccgagagtatccaggctaaggctgcttttgacgtgttggtggttggt
gccggtccggctggtactgcagcggcggtatatgctgcgcgcaagggggtccggacgggt
ttggtcgctgagcgctttggtggccaagtgttggataccatgacgatcgagaacttcata
tctgttccggaaactgatggcccgaggatggttgcggcgctggagcagcatgtgcgtcag
tatgaggtcgatatcatgaatttgcagcgtgtcgagacgttggtaccggctggagagaac
ggctttatcgaggtcagattggccagtggtgcgtcgctgagcagccgcaccgtgattctc
tctacgggtgcacactggcgccagatgaatgtgcctggtgaggatgagtatcgcaacaag
ggggttgcttattgtccgcattgcgatggcccgttgttcaagggtaagcatgtcgcggtg
attggcggtggtaattcgggagtcgaggcagcgatcgacttggctggaattgcttcatat
gtcacgttgcttgagttcgataccaagctgcgtgccgacgaagtattgcaacgcaagcta
cgcagtatgtcgaatgtggaagtcatcatgggtgcccagaccaccgaggtacgtggtgat
ggaaagaaggtgactggtttggtctatgttgatcgcagtactggtggaagctttacattg
gcgttggaaggcgtgtttgtgcagatcggtctgttacccaataccgagtggttgaaaggt
agggtggaattgtctccccgtggagaaattgtcgttgatgaatgtggtcataccagcttg
ccaggtgtgttcgctgctggtgatgcgaccacggtgccgtataagcagattgttattgcg
atgggggagggatctaaagccgcgttgagtgctttcgattatctgattcgtaatgtggtt
gaaattactggaattgctcaggcacaggcagcgtga

DBGET integrated database retrieval system