KEGG   Xylella fastidiosa Hib4: XFHB_04565
Entry
XFHB_04565        CDS       T04925                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00010  Glycolysis / Gluconeogenesis
xfh00020  Citrate cycle (TCA cycle)
xfh00260  Glycine, serine and threonine metabolism
xfh00280  Valine, leucine and isoleucine degradation
xfh00380  Tryptophan metabolism
xfh00620  Pyruvate metabolism
xfh00630  Glyoxylate and dicarboxylate metabolism
xfh00640  Propanoate metabolism
xfh01100  Metabolic pathways
xfh01110  Biosynthesis of secondary metabolites
xfh01120  Microbial metabolism in diverse environments
xfh01200  Carbon metabolism
Module
xfh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xfh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xfh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFHB_04565
   00020 Citrate cycle (TCA cycle)
    XFHB_04565
   00620 Pyruvate metabolism
    XFHB_04565
   00630 Glyoxylate and dicarboxylate metabolism
    XFHB_04565
   00640 Propanoate metabolism
    XFHB_04565
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XFHB_04565
   00280 Valine, leucine and isoleucine degradation
    XFHB_04565
   00310 Lysine degradation
    XFHB_04565
   00380 Tryptophan metabolism
    XFHB_04565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xfh04147]
    XFHB_04565
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     XFHB_04565
Exosome [BR:xfh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   XFHB_04565
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox AlaDh_PNT_C GIDA HI0933_like FAD_binding_3 3HCDH_N FAD_binding_2 Lycopene_cycl DAO FAD_oxidored Thi4 Pyr_redox_3 NAD_binding_8 2-Hacid_dh_C XdhC_C UDPG_MGDP_dh_N DUF1411
Other DBs
NCBI-ProteinID: ALR06239
UniProt: A0A1L2A9Q0
LinkDB
Position
complement(1023158..1024594)
AA seq 478 aa
MSEHYDVVVIGAGPAGYHAAIRAAQLGLKVACVDAALGKDGKPALGGTCLRVGCIPSKAL
LDSSRQYWNMGHLFNEHGISFKDAKIDVATMIARKDKIVKQFTGGIAMLFKANKITPYYG
FAQLQPGNVVKVKQHEGKNIELKGANVILAAGSDSVELPFATFDGETIVDNIGALDFIKV
PKRLAVIGAGVIGLELGSVWKRLGAEVTILEAMPDFLAAVDADVAKTAAKEFKQQGLDIK
LGAKVSRTEISSKNNKKEVIVTYTDASGKQTFTVDKLLVAVGRKAATKGLLADGTGVQLN
ERGQIVVDEHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFETIPWV
IYTEPEIAWVGKTEQELKANNIPYKAGSFPFAAVGRAVAMAEPSGFVKVLAHAETDRVLG
LHLIGVNVSELVHEGVLAMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagtgaacattacgacgtcgttgttatcggagccggtccagctggctatcacgctgca
atccgcgccgcccaactgggtctgaaggtcgcttgcgtcgatgcagcactcggcaaggac
ggtaagccagcgcttggaggcacgtgtctacgcgtgggatgcatcccttccaaagcactg
ctggactcctcccgccagtactggaacatgggacatctattcaacgaacatggcatcagt
tttaaagatgccaagattgatgttgccacgatgatcgctcgcaaagacaaaatcgtgaaa
cagttcacgggtggcattgcgatgctcttcaaagcaaacaaaatcactccctactatgga
tttgcccaattgcaacctggcaacgtagtcaaagtaaaacaacacgagggtaagaacatc
gaactgaaaggcgccaacgtgatcctggcagccggctccgattccgttgaactgccattt
gcaacgttcgacggtgaaacgattgtcgacaatatcggtgccctggactttataaaagtc
ccaaaacgcttggcagtgatcggtgccggagtcatcggtctggaattaggcagcgtatgg
aaacgcctaggtgcggaagtcactattcttgaagcaatgccagactttctagctgcagtt
gacgccgatgtcgccaaaaccgccgccaaggaattcaagcaacaggggctggacatcaag
ctcggcgctaaggtctcccgaaccgaaatctcaagtaaaaacaacaaaaaagaagtcatc
gttacctacactgacgcctccggtaagcagacattcactgtcgacaaactattagtggct
gtcgggcgcaaggccgcaaccaagggattgcttgcagatggcaccggggtacagctcaac
gaacgtggccagatcgtggtggacgaacactgtcataccggtgtcgacggtgtctgggcc
attggcgactgtgtacgtggcccgatgttggctcataaaggcttcgaagaggggatcgca
gtagctgaattgatcgcgggcctgccaggccacgtgaactttgaaaccatcccatgggtc
atctacacagagccggaaatcgcctgggttggtaagactgagcaagaactcaaagcaaac
aacattccttacaaagctggatccttcccgttcgccgcagtcggccgcgccgttgcgatg
gctgagccatctggttttgtgaaagtcctagcgcatgcggaaactgaccgcgtgttaggt
ttacatctgatcggtgtgaacgtctccgaattggtacatgaaggggtattggctatggaa
tttagtggctcagctgacgatctcgcccggatctgccacgcccacccaaccttatcggaa
gcaatccacgacgcagctatggcggtcagcaagcgcgcaatccataaagcaaactga

DBGET integrated database retrieval system