KEGG   Xylella fastidiosa Hib4: XFHB_04735
Entry
XFHB_04735        CDS       T04925                                 

Gene name
gidA
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification protein
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
xfh  Xylella fastidiosa Hib4
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xfh03016]
    XFHB_04735 (gidA)
   03036 Chromosome and associated proteins [BR:xfh03036]
    XFHB_04735 (gidA)
Transfer RNA biogenesis [BR:xfh03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    XFHB_04735 (gidA)
 Prokaryotic type
    XFHB_04735 (gidA)
Chromosome and associated proteins [BR:xfh03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    XFHB_04735 (gidA)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like AlaDh_PNT_C Pyr_redox_3 Pyr_redox
Other DBs
NCBI-ProteinID: ALR06263
UniProt: A0A1L2B002
LinkDB
Position
complement(1055764..1057653)
AA seq 629 aa
MTDSFYGYDVIVIGAGHAGSEAALAAARTGAHTLLLTHNIETIGAMSCNPAIGGIGKGHL
VKEIDALGGAMAHAADAAGIQWRTLNASKGPAVRATRCQADRALYRAAIRQMIEGQARLN
IFQAEVDDLLFEGDTVCGAITHTGLHFKAPAVVLTAGTFLAGKIHIGPTQYAAGRMGDPP
ATMLAARLRERLFTVARLKTGTPPRIDGRTLNYTAMQEQPGDAPRPTMSFIGNSASHPPQ
VSCWITQTTERTHEIIRAALHRSPLYSGQIEGAGPRYCPSIEDKVVRFAEKNSHQIFVEP
EGLNVIDIYPNGISTSLPFDVQLELVRSIRGFEQAHITRPGYAIEYDFFDPRGLKASLET
KAIAGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVRGLSSWTPRRDQAYLGVLVDDLIT
HGTNEPYRMFTSRAEYRLQLREDNADARLTAIGRDLGLVDDARWAHFNAKQEAVARECGR
LSALWATPGNALGREVKETLGVTLSRETNIIDLMKRPELDYAALMRVPSLGPGVDDAQVA
EQVEIGVKYAGYLNRQSEEITRQQRHEATAIPLEFDYAAVRGLSTEVLQKLQHIQPQTVG
QAQRIPGMTPAAISLLLVHLERMRRNRVA
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgactgattccttctatggctacgacgttatcgtcatcggtgctggccatgccggtagc
gaagccgctctggctgccgcacggaccggagcacacaccctattgctgacccacaatatt
gaaaccatcggtgcaatgagctgtaacccagccattggcggcatcggcaagggccacctg
gtcaaagagatcgacgcactcggcggagcaatggcacacgccgcagacgccgctggcatc
caatggcgcactctcaacgcatccaaaggtccggccgtacgcgcgacacgctgccaagca
gaccgcgccttataccgtgccgcaatccggcagatgattgaaggccaagcacgcctcaac
atattccaagccgaagtggacgatctgctgtttgaaggggacaccgtatgcggtgcgatt
acacacactgggttgcatttcaaagcgcctgccgtcgtcctcaccgccggcacattcctt
gctggaaaaatccatatcggaccaacccaatacgccgcgggacgcatgggcgacccgcca
gcaaccatgctagccgcccgcctgcgggaacgtctattcacagttgcacggctcaaaaca
gggaccccaccacggattgatggccggacgctgaactacacagcgatgcaagaacaacca
ggtgacgccccacgccccaccatgtccttcatcggaaactcagcttcccatccccctcaa
gtcagctgctggattactcaaaccaccgaacgcacacatgagatcatccgggccgcccta
caccgctcgccgctgtacagcgggcaaattgagggcgccggcccacgctattgcccatca
attgaagacaaagtggtgcgcttcgccgagaaaaatagccaccaaattttcgttgagcct
gaagggttgaacgtcatcgacatctacccgaacggcatctcaacctcattgcccttcgac
gtacagttagagttggtacgcagcatccgtgggttcgaacaagcacacatcacccgcccc
ggctatgccatcgaatacgacttcttcgacccacgcggactcaaagcgtcactggaaacc
aaagcaatcgctggactgtttttcgctggacagatcaacggcaccaccggctacgaagaa
gccgccgcccaaggcctgctggctggactcaatgccgcacgccatgtgcgtgggctatcc
tcctggacaccacgccgcgaccaagcctacctgggtgttctcgttgacgatttgatcacc
catggcaccaacgaaccgtaccgcatgttcaccagccgagcagagtaccgattacagctg
cgcgaagacaacgccgacgcacgcctcaccgcaatcggccgtgacctaggcctcgtcgac
gatgcacgatgggcacacttcaacgcgaaacaggaagcagtcgcgcgtgaatgtggacgc
ttgtccgcgctgtgggccacaccaggcaacgccctaggtcgtgaagtcaaagaaaccctg
ggagtgacgctcagccgtgaaaccaacatcattgacctcatgaagcggccagaactggat
tacgctgcactgatgcgcgtcccctccctgggtcctggcgtcgatgatgcccaggtcgct
gagcaagtcgagatcggcgttaaatacgctggttatttaaaccgccagtccgaagaaatt
acccgccagcagcgccacgaagcaactgcaatcccacttgaattcgactatgccgcagtg
cgaggactctcgacagaagtcttacaaaagctgcaacacatacagccacagacagtgggt
caagcgcaacgcatcccggggatgacgcctgcagcaatctcgttattactggtacacctg
gaacgcatgcgtcgcaaccgcgtcgcctga

DBGET integrated database retrieval system