KEGG   Xylella fastidiosa Hib4: XFHB_10150Help
Entry
XFHB_10150        CDS       T04925                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00020  Citrate cycle (TCA cycle)
xfh00190  Oxidative phosphorylation
xfh00650  Butanoate metabolism
xfh01100  Metabolic pathways
xfh01110  Biosynthesis of secondary metabolites
xfh01120  Microbial metabolism in diverse environments
xfh01130  Biosynthesis of antibiotics
xfh01200  Carbon metabolism
Module
xfh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xfh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xfh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XFHB_10150
   00650 Butanoate metabolism
    XFHB_10150
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XFHB_10150
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XFHB_10150
    1.3.5.4  fumarate reductase (quinol)
     XFHB_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: ALR07150
UniProt: A0A1L2B2G9
LinkDB All DBs
Position
complement(2165767..2166552)
Genome map
AA seq 261 aa AA seqDB search
MAEFTLPKNSKIGKGTHFPAKSGTKNARTFKVYRWNPDDDANPRTDTYEIDLDTCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKAISACTISEIPIYPLPHM
NVIKDLIPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPGDRKKLDGLYECILCACCST
SCPSYWWNGDRYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLYRCHTIMNCTRTCP
KGLNPAQAIAEIKKLMMLRRA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttcactctccctaagaattcgaagatcggtaaggggacgcattttcccgcc
aaaagcggtactaaaaatgctcgcacctttaaggtctaccgttggaatccggatgatgat
gccaatccgcgtaccgatacctacgagattgatttagatacatgcggcccgatggttttg
gatgcgttgatcaagattaagaatgagatcgacccgactctgacgttccgtcgttcttgc
cgtgagggtatttgtggctcatgtgcgatgaacattgatgggaccaacacgttagcttgt
accaaggcgattagtgcatgcaccatatctgagatcccgatctatccactgcctcacatg
aacgtgatcaaggatttgatccccgacttgactcacttttatgcgcagtacgcttctatt
aagccctggatacgtactcagaccccgccgccgcctgatcgtgagcgattgcagtctcct
ggggaccgcaagaagcttgacggtttgtatgagtgcattctatgtgcctgttgctcgacg
agttgtccgagttactggtggaatggtgatcgctatttgggtccggcgatcttgctgcag
gcttaccgctggattatcgattcacgtgatgaagatactggcgcgcgcttggatgatctc
gaggatccattcaagttatatcgttgtcataccatcatgaattgcacgcgaacctgtccg
aagggattgaatcccgctcaggccattgccgagatcaaaaaactgatgatgctgcgtcgc
gcctga

DBGET integrated database retrieval system