KEGG   Xylella fastidiosa Hib4: XFHB_10155Help
Entry
XFHB_10155        CDS       T04925                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00020  Citrate cycle (TCA cycle)
xfh00190  Oxidative phosphorylation
xfh00650  Butanoate metabolism
xfh01100  Metabolic pathways
xfh01110  Biosynthesis of secondary metabolites
xfh01120  Microbial metabolism in diverse environments
xfh01130  Biosynthesis of antibiotics
xfh01200  Carbon metabolism
Module
xfh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xfh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xfh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XFHB_10155
   00650 Butanoate metabolism
    XFHB_10155
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    XFHB_10155
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     XFHB_10155
    1.3.5.4  fumarate reductase (quinol)
     XFHB_10155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-ProteinID: ALR07151
UniProt: A0A1L2B2I9
LinkDB All DBs
Position
complement(2166573..2168363)
Genome map
AA seq 596 aa AA seqDB search
MSAYTITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAAL
GNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEHYGVPFSRTAQGKIYQR
PFGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDARFMIEYFALDLIFDNEGV
CCGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTCTGDGGGLVMRAGLPMQDM
EFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMIIE
IREGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIFAGVDVTKQPIPVLPTVHYNM
GGIPTNYHGEVVRKVGNDPDAVVPGLYAVGEAACVSVHGANRLGSNSLLDLVVFGRAVAN
RCAETIKPNQPHKVLPSDSCDKALGLLDKLRHADGSMPTAVIRDRMQRTMQSDASVFRTS
KTLQEGCEKMNEIFALFDDVKVSDRSLVWNSDLIETYELHNLLLNALATINSAEQRKESR
GAHAHEDYPDRDDENWLKHTLVSVDEKGTCSFDYRPVHMYTLSKDVDVIPPKPRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttatacaattaccgaacacaaatatgacatggttgtcgttggtgctggcggt
gctggtctacgtgccacgttcggtttggctcagaaaggcttgcagactgtctgcctgaca
aaagtattcccgacgcgttcgcataccgtcgctgcgcaaggtggtatctccgctgcgctt
ggtaacatgggagaggatgactggcgctaccatttttatgacaccatcaaagggtcagac
tggctgggtgaccaggatgcgattgagtacatgtgccgtgaggcaatcccggctgtgatc
gaactagaacactatggggttccgttctcgcgtactgcacaaggcaagatttaccagcgg
ccatttggtgggatgacgacacgttacggtgaggggccgcgggcagagcgtacctgcgct
gcagctgatcggaccggtcatgcgatgttacataccttgtaccagcaagcattggcgcac
gacgcgcgtttcatgattgagtactttgcacttgatttgatcttcgacaacgagggtgtg
tgttgcggcgtgttggcgttggacatggccgagggatccttgcacctgtttcgtgcccat
ggagtcgtgttggcgactggtggctacggtcgcacgtacttcagtgcaacttctgctcat
acctgtactggtgatggtggtggcttggtgatgcgtgccggtttaccaatgcaggatatg
gagtttgtgcagttccatcccacaggaatctatggggctggctgcctcatcaccgaagga
gtgcgtggtgagggaggaatcttgcgtaactctaacggggagcgcttcatggagcgctat
gcaccgcactacaaggatctggcctctcgtgatgtggtgagtcgctcaatgattattgag
atccgggaggggcgcggcgttggtgaacacaaagaccatattttgcttgatttgactcac
ttgggtccgagcatgatccaagaaaaattgcctggcattgccgagagtgcccgcatcttc
gctggcgtggatgtgaccaagcagccgattccggtgctcccaacagtgcattacaacatg
ggtggtattccaaccaattaccatggcgaagtggtgcgtaaggttggtaatgatcctgat
gcagtggtgccggggctatatgcggttggtgaagcggcctgtgtatcggtgcacggtgcc
aatcgtttgggatcgaattcgttgcttgatttggtggtattcggtcgtgcggttgccaat
cgttgtgccgaaacaatcaagccaaatcagccgcataaggtgttgccgtcggatagttgc
gacaaggcgctgggcttgcttgataaacttcgccatgctgacggttccatgccgacagcg
gtgattcgcgacaggatgcaacggaccatgcagtctgatgcgtcggtgtttcgtacgagt
aagacgttgcaagaagggtgcgaaaagatgaatgaaatctttgccttgtttgatgacgtc
aaggtttctgatcgttcacttgtttggaattcggatttgatcgagacctacgagctgcac
aatttgctgttaaacgcactggctacgattaactcggctgaacagcgcaaagagagccgt
ggtgctcatgcgcatgaagattatccagatcgcgatgacgagaattggttgaaacacaca
ttggtcagtgtcgacgaaaagggcacatgcagttttgactaccgcccggtgcacatgtac
acgctcagcaaagacgtggatgtgatacctcctaagccacgcgtctattga

DBGET integrated database retrieval system