KEGG   Xylella fastidiosa Hib4: XFHB_11310Help
Entry
XFHB_11310        CDS       T04925                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00550  Peptidoglycan biosynthesis
xfh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XFHB_11310
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XFHB_11310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xfh01011]
    XFHB_11310
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xfh03036]
    XFHB_11310
Enzymes [BR:xfh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XFHB_11310
Peptidoglycan biosynthesis and degradation proteins [BR:xfh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   XFHB_11310
Chromosome and associated proteins [BR:xfh03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    XFHB_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ALR07336
UniProt: A0A1L2B322
LinkDB All DBs
Position
complement(2449622..2451463)
Genome map
AA seq 613 aa AA seqDB search
MKSRNNRFRSHFNLRGRLLLVGTALGLCSMTLIASAAYVQLINSDFYQRQAEARYLRELP
IPTSRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVLDVPMDELRTRLSQK
ADKEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQGEAMAHVLGFTNIDDRGQEG
LELSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRN
AIVENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVTGINSSARRNRAVTDLVEPGSTMK
PLTVATALQAGVVTPDTVIDTNPGYLSLGRFTIRDVPRNNGVLNVAGVITRSSNIGAAKI
VAKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQ
IAQAYATLGNGGKLVPPTFVKGHHAEARQVVDAKVAQQVIGMMETVVTRGGAKAAAILGY
HVAGKTGTARKTGANGYESGHYNALFAGLVPATRPRFATVIVINDPQGKAYYGGLVSAPV
FHRVMEGALRLMDVPPDDIQSWLAAQAAGKTGRTPLRQVDPDLALVPDAVDEVAAGIPTT
VTPAPSAIQRDRQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccgtaataaccgcttccgcagtcatttcaatttgcgtggtcggttgttgctg
gtcggtacagcgctgggcctgtgttcaatgacgttgatcgccagtgctgcctacgtgcag
ttgattaatagtgatttctatcaacgtcaggcggaagcgcgctacttgcgtgagctgccg
attccgacctcgcgtggaatgattacagatcgcaatggtgagccgttggcggtttctacg
ccggtggagtcgatttggggaaatccacaggaactgttgcggaatcctgatgcgatctcg
aagttggctaaggtacttgatgtcccgatggacgaactgcgtactcgtttgtcgcagaag
gccgataaagagttcatgtatttgaagcgccggatcaatcctgacgttgcacatcacgtt
cttgggttgcaaattcctggggtatttgcgcagcgtgaattcaggcgtttctaccctcag
ggtgaggcaatggcgcatgtattgggttttaccaatattgatgaccgtggccaggaaggt
ctggagctgtcatttgatgattggttgacaggtaagcctggtagcaagcgtgtggtacgt
gatgcgcgtggcgccattgtggagagtgtggatgcgatccggtcggcgcagccgggtaag
gatttggtgttgacgattgatcgtcgtattcaatttcttgcttataaggaactgcgcaac
gccattgttgaaaatcaagcggctggtggttcgattgtcgtcatggatgtgaacaatggc
gagattctagccatggtcaatttgccgacctacaaccctaacgcggtgaccgggattaat
tcttcagcacggcgtaatcgtgcggtgacggatctggttgagccaggttcgacgatgaag
ccgttgacggttgcgaccgcgctgcaagcgggtgtggtgacccctgatacggtcattgat
accaatcctggttatctgtcactgggacgttttaccatccgcgatgtgccgcgtaataac
ggtgtgctcaatgtggctggtgtgattacgcgcagttccaacattggtgctgccaagatc
gtcgccaaggtgccggacaaaacgttctacgaattggtgcaaggttttggttacgggaca
gcgcctcatagcggttttcctggtgaatccagcggtgtgttgcctttaccggcacgttgg
agcggtacttccaagaccactatgtcttacggttacggtctgtctgtgacgccgttgcaa
attgcgcaggcgtacgcgacgttgggcaatggcggcaagctagtcccgccgacgttcgtc
aaaggccatcatgccgaggcacgtcaagtcgttgatgccaaggttgcacagcaagtgatt
ggcatgatggaaacggtggtcacccgtggaggggctaaggctgcggcgatccttggttac
catgttgctggaaagacgggcacggcgcgcaaaacgggcgctaatggctacgaatccggt
cattacaatgcgctgtttgctggtttggtacctgccacgcgcccgcgcttcgcgacggtc
attgtgatcaacgacccgcagggtaaggcgtattacggcggcttggtatctgcacccgtg
ttccatcgggtgatggagggggcgttacggttgatggatgtgcctcctgacgacattcaa
tcatggttggctgcgcaggctgcaggaaaaactgggcggacgccgctgcggcaggtcgat
cccgatctggcattggtacccgatgctgtcgatgaggtcgccgctggtattcctacgacg
gtgacaccagcgccgtctgcgattcagagagatcgccaatga

DBGET integrated database retrieval system