KEGG   Xylella fastidiosa Hib4: XFHB_12500Help
Entry
XFHB_12500        CDS       T04925                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    XFHB_12500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xfh03400]
    XFHB_12500
Enzymes [BR:xfh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     XFHB_12500
DNA repair and recombination proteins [BR:xfh03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     XFHB_12500
 Prokaryotic type
     XFHB_12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ALR07532
UniProt: A0A1L2AIU9
LinkDB All DBs
Position
complement(2709731..2710492)
Genome map
AA seq 253 aa AA seqDB search
MNEQGEAINNSAESRIQLESSWKAHVGNWLLRPEMRDLSAFLRARKVAGVSVYPPGSQIF
AAFEATPFQRVKAVILGQDPYHGQGQAHGLCFSVRPGMPLPPSLLNIYKELEEDLGLLRP
DHGCLLPWAKRGVLLLNAVLTVEDGRAGAHQGKGWEGFTDHVVDTLNREREGLVFMLWGS
YAQAKGKVIDTRRHLVLKAAHPSPLSAHRGFLGCRHFSLCNQYLSQHGLGMVDWSLPPCI
ALDGAILNGRIAV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcaaggtgaggccattaataatagtgccgagtctcgaattcagttggaatct
tcttggaaggcgcacgttggtaattggttattgcgtccggaaatgcgggatttgtctgcc
ttcctgcgtgcgagaaaggttgctggtgtgagtgtctacccaccgggatctcagatattt
gcggcgttcgaagcgaccccattccagcgggtcaaggctgtaatccttggtcaagatcct
tatcacggtcaaggccaagcgcatggtttgtgtttttcagtgcggccaggtatgccgttg
ccgccttctttgttgaatatttataaagagctcgaagaagatcttgggttgcttcgccct
gatcatggctgtctgcttccttgggcaaagcgtggtgtattgctacttaatgcggtactg
acggtggaggatggtcgtgcaggtgcgcatcagggtaagggctgggaaggttttaccgac
catgtcgttgataccttaaatcgcgagcgtgaaggacttgtattcatgctctggggtagc
tatgcccaagccaagggtaaggttattgatacgcgtcgccaccttgtactcaaggctgcg
cacccttcacctttgtcagcgcatcgtggttttctgggttgccgtcatttttctctctgc
aaccagtacttgagccaacatggcttggggatggtggattggagcttgccgccatgtatt
gcactggatggtgcaatcttaaatggtagaatagcggtgtag

DBGET integrated database retrieval system